KEGG   Bacillus subtilis subsp. subtilis 168: BSU14170Help
Entry
BSU14170          CDS       T00010                                 

Gene name
ykuP
Definition
(RefSeq) flavodoxin-2
  KO
K03839  flavodoxin I
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    BSU14170 (ykuP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavodoxin_1 Flavodoxin_5 Flavodoxin_3 FMN_red
Motif
Other DBs
NCBI-GeneID: 938811
NCBI-ProteinID: NP_389300
Pasteur: BG13300
BSORF: BG13300
UniProt: O34589
Position
1488413..1488868
Genome map
AA seq 151 aa AA seqDB search
MAKILLVYATMSGNTEAMADLIEKGLQEALAEVDRFEAMDIDDAQLFTDYDHVIMGTYTW
GDGDLPDEFLDLVEDMEEIDFSGKTCAVFGSGDTAYEFFCGAVDTLEAKIKERGGDIVLP
SVKIENNPEGEEEEELINFGRQFAKKSGCAV
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttggcgaagattttgctcgtttatgcaacaatgtcaggcaacactgaagctatggcagat
ttgattgaaaaggggcttcaggaggcgttagcagaagtagaccgtttcgaagcaatggat
attgatgatgcccagctgtttaccgattatgaccatgtcataatgggaacctacacgtgg
ggagacggagatctgcctgatgaatttttagatcttgttgaagacatggaggagattgat
ttttccggcaaaacatgcgctgtattcggttccggtgatacagcatatgaatttttctgc
ggagcggttgatacgctagaggcaaaaataaaagaacgcggtggagacattgtgctgcct
tcggtaaaaatcgaaaataatccagaaggtgaagaagaggaagaattaataaacttcggg
agacaattcgcaaagaaaagcgggtgcgctgtctga

DBGET integrated database retrieval system