KEGG   Bacillus subtilis subsp. subtilis 168: BSU14180Help
Entry
BSU14180          CDS       T00010                                 

Gene name
dapH
Definition
(RefSeq) 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase
  KO
K05822  tetrahydrodipicolinate N-acetyltransferase [EC:2.3.1.89]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00300  Lysine biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Module
bsu_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    BSU14180 (dapH)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.89  tetrahydrodipicolinate N-acetyltransferase
     BSU14180 (dapH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DapH_N Hexapep Hexapep_2
Motif
Other DBs
NCBI-GeneID: 939193
NCBI-ProteinID: NP_389301
Pasteur: BG13301
BSORF: BG13301
UniProt: O34981
Position
1488973..1489683
Genome map
AA seq 236 aa AA seqDB search
MKMMDANEIISFIQNSTKSTPVKVYVKGELEGINFGESAKAFINGNTGVVFGEWSEIQTA
IEENQSKIEDYVVENDRRNSAIPMLDLKNIKARIEPGAIIRDQVEIGDNAVIMMGASINI
GSVIGEGTMIDMNVVLGGRATVGKNCHIGAGSVLAGVIEPPSAKPVVIEDDVVIGANAVV
LEGVTVGKGAVVAAGAIVVNDVEPYTVVAGTPAKKIKDIDEKTKGKTEIKQELRQL
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgatggacgcaaatgaaattatttcatttattcaaaatagtacaaaatctaca
cctgtaaaggtttacgtgaaaggtgagctggaaggaatcaatttcggtgaatctgcgaaa
gcttttatcaatggaaacactggtgtcgttttcggtgaatggagcgaaatccaaacagca
atcgaagaaaaccaaagcaaaatcgaagactatgtggttgaaaatgaccgccgcaattct
gcgatcccaatgcttgatcttaaaaacatcaaagcgcgtatcgagccgggtgcgatcatc
cgcgaccaagttgaaatcggtgataacgcagtcatcatgatgggtgcttctattaatatc
ggttcagtcatcggcgaaggcacaatgattgatatgaacgttgtgcttggcggacgagct
actgttggaaaaaactgccatatcggcgcgggttctgtacttgcgggcgttattgagccg
ccatccgctaaaccggttgtgattgaagacgacgtcgtaatcggcgcaaatgctgttgtg
cttgaaggtgtaacagtaggtaaaggagctgttgttgctgcgggagcgatcgtggtaaac
gacgttgagccatacactgtcgttgcaggcacaccagctaaaaaaatcaaagacattgat
gaaaaaacaaaaggcaaaactgaaatcaagcaggaattacgccagctgtaa

DBGET integrated database retrieval system