KEGG   Bacillus subtilis subsp. subtilis 168: BSU14190Help
Entry
BSU14190          CDS       T00010                                 

Gene name
dapL
Definition
(RefSeq) N-acetyldiaminopimelate deacetylase
  KO
K05823  N-acetyldiaminopimelate deacetylase [EC:3.5.1.47]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00300  Lysine biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Module
bsu_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    BSU14190 (dapL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bsu01002]
    BSU14190 (dapL)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.47  N-acetyldiaminopimelate deacetylase
     BSU14190 (dapL)
Peptidases [BR:bsu01002]
 Metallo Peptidases
  Family M20
   BSU14190 (dapL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer FAD_binding_4
Motif
Other DBs
NCBI-GeneID: 938805
NCBI-ProteinID: NP_389302
Pasteur: BG13302
BSORF: BG13302
UniProt: O34916
Position
1489753..1490877
Genome map
AA seq 374 aa AA seqDB search
MKIEELIAIRRDLHRIPELGFQEFKTQQYLLNVLEQYPQDRIEIEKWRTGLFVKVNGTAP
EKMLAYRADIDALSIEEQTGLPFASEHHGNMHACGHDLHMTIALGIIDHFVHHPVKHDLL
FLFQPAEEGPGGAEPMLESDVLKKWQPDFITALHIAPELPVGTIATKSGLLFANTSELVI
DLEGKGGHAAYPHLAEDMVVAASTLVTQLQTIISRNTDPLDSAVITVGTITGGSAQNIIA
ETAHLEGTIRTLSEESMKQVKERIEDVVKGIEIGFRCKGKVTYPSVYHQVYNTSGLTEEF
MSFVAEHQLATVIEAKEAMTGEDFGYMLKKYPGFMFWLGADSEHGLHHAKLNPDENAIET
AVHVMTGYFSVYAN
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaagatagaggagctcatcgcaattcgcagagatctgcatcgtataccggagcttgga
tttcaggagttcaaaacccagcagtatttattaaatgtcttggaacaatatccgcaagac
agaattgaaattgagaaatggcgaacagggctttttgtaaaagtgaacgggacggcgccg
gaaaaaatgctggcatacagagcggatatcgatgcgctttctatagaagagcaaactggt
cttccattcgcatcagagcatcacggcaacatgcacgcctgcggtcacgatttgcatatg
acaattgcactcggcattattgatcattttgttcaccacccagtcaaacatgatttgctt
tttctgtttcagccggcagaggaagggcctggcggtgcggaaccaatgcttgagagcgat
gtattaaaaaaatggcagcctgatttcatcactgcccttcatattgctccagagcttccg
gtaggcaccattgcgacaaaaagcggccttctatttgcgaatacatcagagctagtcatc
gatctggaaggcaaagggggacatgcggcatatccgcatttggctgaggatatggttgta
gcagcaagtacacttgtcacccagctgcaaacgattatctctagaaacacagatccgcta
gacagtgctgttattacagttggtaccattaccggaggctcggcacaaaatatcattgca
gaaacggcccacctggaaggcacgatccgcacgctttctgaagaatcgatgaaacaagta
aaggaacggattgaagatgtagtgaaaggaatcgaaatcggattccgctgcaaaggaaaa
gtgacatatccgtctgtatatcaccaagtttacaatacgagcggattaacagaagaattt
atgtcttttgttgctgaacatcaactggcgacagtaattgaagcaaaagaagcaatgact
ggagaggattttggctatatgctgaaaaaatatcccggattcatgttctggctcggcgct
gattctgaacatgggcttcatcatgctaagctgaatcccgatgaaaatgcgatagaaaca
gcggttcatgtcatgacaggttatttttctgtttatgccaattaa

DBGET integrated database retrieval system