KEGG   Bacillus subtilis subsp. subtilis 168: BSU14200Help
Entry
BSU14200          CDS       T00010                                 

Gene name
ykuS
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0180 DUF5540 IreB DUF2312
Motif
Other DBs
NCBI-GeneID: 938799
NCBI-ProteinID: NP_389303
Pasteur: BG13303
BSORF: BG13303
UniProt: O34783
Position
1490939..1491184
Genome map
AA seq 81 aa AA seqDB search
MAKKIGIEQSLSDVEAALKEKGYDVVMMKSPADAQGCDCCVVTGLDNNVQGIADTVTQAP
VITASGMTAEEICSEVESRIQ
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaaaattggaattgaacaatcgttatcagatgtagaagctgctttaaaagaa
aaaggatatgacgttgtaatgatgaaaagccctgctgatgctcaaggctgtgactgctgt
gtcgtaacaggtcttgataataatgtgcaagggatagccgatacggtaacacaagcacct
gtcattacagcttccgggatgacggctgaagaaatttgtagcgaagttgagagcagaatt
cagtaa

DBGET integrated database retrieval system