KEGG   Bacillus subtilis subsp. subtilis 168: BSU14210Help
Entry
BSU14210          CDS       T00010                                 

Gene name
ykuT
Definition
(RefSeq) MscS family protein YkuT
  KO
K22044  moderate conductance mechanosensitive channel
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU14210 (ykuT)
Transporters [BR:bsu02000]
 Other Transporters
  Pores ion channels [TC:1]
   BSU14210 (ykuT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MS_channel DUF443 TRP DUF1279 Saf_2TM
Motif
Other DBs
NCBI-GeneID: 938809
NCBI-ProteinID: NP_389304
Pasteur: BG13304
BSORF: BG13304
UniProt: O34897
Position
complement(1491221..1492024)
Genome map
AA seq 267 aa AA seqDB search
MDFIKQYDWAGLITNAGVLLIKLAIMILLYFIVRSLGMKIIKHLFAKFEEQNSLSIGRAH
TLRSLTLNIFAYTLIFIFFVMVLDLFHYDPSALLAGAGIVGLAVGFGAQGLVSDIVTGFF
ILLEKQLDVGDYITVSTFDGIVEQVGLRTTQIRSFDGTLHYIPNRNITNVSNHSRGTMQA
LVDIKVPAERNIDEMIHILQQVCDETAAALPQIKEGPNVIGIQELGTSEIVIRVIAKTEN
MEQWRVERVLRKEIKNAFDRAFPKETE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggactttattaaacaatatgattgggcgggactgattacaaatgccggtgttctgctc
attaaactcgccattatgatattgctctattttatcgttcgatcattaggcatgaaaatc
attaaacatctgtttgcaaaattcgaggagcagaatagcttgtctatcggacgtgcacat
acgctccgaagcctgactcttaacatatttgcttatacattgattttcatatttttcgtc
atggttctagatttgtttcattatgatccaagcgctcttttagcgggggcaggaatcgtc
ggcctggctgtcggatttggcgcccaagggcttgtcagtgatatcgtgacaggttttttt
attttgcttgagaaacaattggatgtcggagattatattaccgtttccacctttgacgga
attgtcgagcaggttggcttaaggacaactcaaatccgcagctttgacggaacactgcat
tacatccccaacagaaacatcacaaacgtgagcaatcattctcgtggtaccatgcaggct
cttgttgacattaaagtgccggctgaaagaaatattgatgaaatgattcatattttacag
caggtttgtgatgaaacggcagcggctcttccacaaataaaagaaggcccaaatgtcatc
gggattcaagaactggggacttctgaaattgtaatcagggtcattgccaaaacagaaaat
atggaacagtggcgagtcgaacgagtgttgagaaaagaaataaagaacgcgttcgaccgc
gctttccctaaagaaacagaataa

DBGET integrated database retrieval system