KEGG   Bacillus subtilis subsp. subtilis 168: BSU14220Help
Entry
BSU14220          CDS       T00010                                 

Gene name
ykuU
Definition
(RefSeq) thioredoxin
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C
Motif
Other DBs
NCBI-GeneID: 938810
NCBI-ProteinID: NP_389305
Pasteur: BG13305
BSORF: BG13305
UniProt: O34564
Position
1492261..1492803
Genome map
AA seq 180 aa AA seqDB search
MAERMVGKQAPRFEMEAVLASKEFGKVSLEENMKNDKWTVLFFYPMDFTFVCPTEITAMS
DRYDEFEDLDAEVIGVSTDTIHTHLAWINTDRKENGLGQLKYPLAADTNHEVSREYGVLI
EEEGVALRGLFIINPEGELQYQTVFHNNIGRDVDETLRVLQALQTGGLCPANWKPGQKTL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacgtatggtaggtaaacaagctcctcgttttgaaatggaagcagtccttgca
agcaaagaattcggcaaagtaagtcttgaggaaaacatgaaaaacgacaaatggacagtg
ctgttcttctatccaatggacttcacttttgtttgtccgacagaaattacagcaatgtct
gaccgctatgacgagttcgaagatcttgatgcagaagtcatcggggtttcaactgatacc
atccatactcatttagcttggatcaatacagaccgcaaagaaaacggtcttggccagctg
aaatacccgcttgctgctgatacaaaccatgaggtatcccgggaatatggcgttttaatc
gaagaagaaggtgtggctttgcgcggattgtttattattaatcctgaaggggagcttcaa
tatcaaactgttttccataacaacattgggcgtgatgttgatgaaacgcttcgtgttctc
caggcgctgcaaactggcggactctgtccggctaactggaaaccaggccaaaaaacactt
taa

DBGET integrated database retrieval system