KEGG   Bacillus subtilis subsp. subtilis 168: BSU14230Help
Entry
BSU14230          CDS       T00010                                 

Gene name
ykuV
Definition
(RefSeq) thiol-disulfide oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AhpC-TSA Redoxin Thioredoxin_8 Thioredoxin Thioredoxin_2 TraF Thioredoxin_4
Motif
Other DBs
NCBI-GeneID: 938804
NCBI-ProteinID: NP_389306
Pasteur: BG13306
BSORF: BG13306
UniProt: O31699
Structure
PDB: 

Position
1492875..1493321
Genome map
AA seq 148 aa AA seqDB search
MKLRQPMPELTGEKAWLNGEVTREQLIGEKPTLIHFWSISCHLCKEAMPQVNEFRDKYQD
QLNVVAVHMPRSEDDLDPGKIKETAAEHDITQPIFVDSDHALTDAFENEYVPAYYVFDKT
GQLRHFQAGGSGMKMLEKRVNRVLAETE
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacgtcagcccatgccggaattgacgggagaaaaagcttggttaaatggtgaa
gtgacgagagagcaattgattggggaaaagccgacgcttattcatttctggtccatcagc
tgccacttgtgcaaagaagcgatgccgcaagtgaatgaatttcgtgataaatatcaagat
cagctgaatgttgtagctgtacacatgccccgttccgaagatgatcttgaccctggtaaa
attaaagaaacagctgctgaacacgatatcactcagccgatttttgttgacagtgaccat
gctttaaccgatgcatttgaaaatgaatatgtacctgcatattatgtgtttgataaaaca
ggacagctccgtcacttccaagccggcgggagcggtatgaaaatgcttgaaaaacgtgtg
aaccgcgttctggctgaaacggaatag

DBGET integrated database retrieval system