KEGG   Bacillus subtilis subsp. subtilis 168: BSU14250Help
Entry
BSU14250          CDS       T00010                                 

Gene name
yknT
Definition
(RefSeq) sporulation protein cse15
  KO
K06437  sigma-E controlled sporulation protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU14250 (yknT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YgaB Terminase_3C ComX DUF724
Motif
Other DBs
NCBI-GeneID: 938787
NCBI-ProteinID: NP_389308
Pasteur: BG12251
BSORF: BG12251
UniProt: O31700
Position
complement(1494403..1495368)
Genome map
AA seq 321 aa AA seqDB search
MKRSGPFFHDVSQENLYLKSELSRCHKLISELEASYFHQKNNKLLKENTDMKEKLQQLSA
ELTHMSTKEKHASHTSQTLHQIRAELLDKIVVLQELLSAETYKRRAEIEEKHKLHIAKVK
IEEENKNLHKRISELQASIEQEQNALLQAKQQAELIKAENGRLKEQMVEKEYQLKHIKIE
VDHMKDRIIETKERLLDIEKTKEKLFHETIISYKRQLDESDAWIASHFADIDGGTKQKEK
TEEEAPAAYAQPNHVETILEDVTKQIHVLQKQLAHAQSSDQAKSHTIEELKNRAAEEKPY
QKWVYKLNLEKENKPSQKKPQ
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagatcaggtccttttttccacgacgtgtctcaggagaacctttatttaaaatcc
gagctttcaaggtgccataagctgatttctgaacttgaagcaagctactttcatcagaaa
aataacaaactgctcaaagaaaataccgatatgaaagaaaaactccagcagctgtctgcc
gaattaacacatatgtcaacaaaagaaaaacatgcctcccacaccagccaaaccctgcac
caaataagagctgaactgcttgataaaatcgttgttttgcaggagcttctatctgctgaa
acctataaacgcagagccgaaatcgaagaaaaacataaacttcatattgcgaaagtcaaa
atcgaagaagaaaataaaaatcttcataaacggatcagcgaacttcaagcctcaattgag
caggaacaaaatgcactgcttcaggcaaaacagcaagccgaattgataaaagccgaaaac
gggcgtctaaaagagcaaatggtagaaaaagaatatcagctaaaacatattaaaatagaa
gttgatcatatgaaagatcgaatcatagaaacgaaagaaagactgctagacatagaaaaa
acgaaagaaaaattatttcacgaaactattatatcgtataaacggcaacttgatgaaagc
gatgcctggattgcttctcattttgccgatattgatggcggcacgaaacaaaaagaaaaa
acggaagaagaagctccagcggcctacgcgcagccaaatcatgtagagactatccttgaa
gatgtcaccaaacagatacatgtgcttcaaaaacagcttgcccacgcccaatcatcagac
caggccaagagccatacaatcgaagagctgaaaaacagagccgctgaagaaaagccttat
caaaagtgggtgtataagcttaatcttgaaaaagaaaacaaaccttcacagaaaaaacct
caataa

DBGET integrated database retrieval system