KEGG   Bacillus subtilis subsp. subtilis 168: BSU14260Help
Entry
BSU14260          CDS       T00010                                 

Gene name
mobA
Definition
(RefSeq) molybdenum cofactor guanylyltransferase
  KO
K03752  molybdenum cofactor guanylyltransferase [EC:2.7.7.77]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00790  Folate biosynthesis
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BSU14260 (mobA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.77  molybdenum cofactor guanylyltransferase
     BSU14260 (mobA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transf_3
Motif
Other DBs
NCBI-GeneID: 938791
NCBI-ProteinID: NP_389309
Pasteur: BG12621
BSORF: BG12621
UniProt: O31701
Position
1495505..1496104
Genome map
AA seq 199 aa AA seqDB search
MKHVNVLLAGGASRRFGEPKAFVKWKGRMLYECAKEALGEQTVIISRPEFIDRFQENGEN
EVYQDAEPFQGMGPLAGIYTAFKKTDGDLYTVLSCDTPLIQRRTMLELKRLMIAGADAVV
PISDGQVQPLIAIYHKRIMPVLYDQLSEKRLRISDLLGRISVCYVQAENIGANPAEFINI
NTRDDFSCLEEKSNSLKRD
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatgtaaacgtactgctggcagggggagcctcacgtcgctttggagaaccgaag
gcgtttgtcaaatggaagggcaggatgctttacgaatgcgctaaagaggcacttggagaa
caaacggttatcatcagccgtcccgaatttattgatagatttcaagaaaacggtgaaaat
gaagtgtatcaagatgctgagccatttcaaggcatggggccattggctggtatatatacc
gcttttaaaaagacagacggtgatctttatactgttctttcctgtgacacaccgctgata
caaagaaggacgatgctggagctcaaacgtctgatgattgccggtgcggacgcggtagtc
ccaatttcagacggacaagtgcagccattgattgcgatttaccacaaacgtatcatgcca
gttctatacgatcagctttctgagaagaggttgagaatatcagatttattaggcagaatt
tcggtttgttacgtacaggctgaaaatatcggagcaaacccggcagagtttatcaacatt
aatacacgtgatgattttagctgtttggaagaaaaatcgaactccctcaagcgggactga

DBGET integrated database retrieval system