KEGG   Bacillus subtilis subsp. subtilis 168: BSU14270Help
Entry
BSU14270          CDS       T00010                                 

Gene name
moeB
Definition
(RefSeq) molybdopterin-synthase adenylyltransferase
  KO
K21029  molybdopterin-synthase adenylyltransferase [EC:2.7.7.80]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    BSU14270 (moeB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.80  molybdopterin-synthase adenylyltransferase
     BSU14270 (moeB)
Ubiquitin system [BR:bsu04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   BSU14270 (moeB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ThiF Shikimate_DH Sacchrp_dh_NADP NAD_binding_7 TrkA_N ApbA FAD_binding_3 DAO 2-Hacid_dh_C AlaDh_PNT_C F420_oxidored DapB_N NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 938780
NCBI-ProteinID: NP_389310
Pasteur: BG12624
BSORF: BG12624
UniProt: O31702
Position
1496155..1497174
Genome map
AA seq 339 aa AA seqDB search
MEERYSRQIRFKQIGEEGQKRLADSHVLIVGAGALGTAGAEGLSRAGVGTITIIDRDYVE
WSNLQRQQLYTESDAKLRMPKAMAAKEHLSAINSEIHIEAYVTEGTAETLEPLIEKADVV
IDATDNFETRMLINDLAQKTKTPWVYGACVSSQGMFMTVIPGETPCLSCLFEQIPVGGAT
CDTAGIIPPAVHIVSAYQQAEALKLLTGQKEAIQRGFVTFDVWNNSHMKINVNHVRREEC
PSCGANAVYPYLQDWNTPKAAVLCGRDTVQVRSESLKRIPKQELIKRLKTIGKVEANAFL
LHIFYEDFRIVIFNDGRALVHGTNDVKEANSVLARVIGL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggaggaacgttattcacggcaaatcagatttaagcaaattggggaagagggccagaaa
agactggcagacagccatgtgctgattgtcggagcgggagcgctcggcactgcaggagct
gaagggctttcgagagcgggagtcggtacgattaccattattgaccgtgactatgtggag
tggagcaatcttcaaaggcagcagctttatacagaaagcgatgccaaactccgcatgccg
aaagccatggctgccaaagagcatctatcagcgattaacagcgagatacatattgaggcg
tatgttaccgaaggaacagccgaaacgcttgagccgctgattgaaaaagcagatgtcgtg
atcgacgcgacagataattttgaaacccgcatgctgataaacgatcttgcccagaaaaca
aagacaccttgggtctatggcgcctgtgtaagcagccagggaatgttcatgactgtcatt
cccggagaaaccccttgtctgtcttgtttgtttgagcaaattcctgtcggcggggcgacg
tgtgatactgccggcattattccgcctgctgtgcatatcgtttcagcatatcagcaggct
gaggcattaaagctgttaaccggccaaaaagaagcaatacagcgggggtttgtgacattt
gatgtctggaacaattcgcatatgaagattaacgttaatcatgtacgccgtgaggaatgc
ccatcttgcggagctaatgcggtatatccttatcttcaggattggaacacaccaaaagct
gctgtactatgcggccgtgatacagtgcaggtaaggtcagaatcattaaaaagaatcccg
aaacaggagctcattaagcggctgaaaacaatcggcaaggtcgaggctaatgcgtttttg
ctgcatattttttacgaggatttcagaattgtcattttcaatgacggacgggcactggtg
catggaacaaatgatgtgaaagaagccaactccgtgttggcaagagtgattggactgtaa

DBGET integrated database retrieval system