KEGG   Bacillus subtilis subsp. subtilis 168: BSU14280Help
Entry
BSU14280          CDS       T00010                                 

Gene name
moeA
Definition
(RefSeq) molybdopterin molybdenumtransferase
  KO
K03750  molybdopterin molybdotransferase [EC:2.10.1.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00790  Folate biosynthesis
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BSU14280 (moeA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.10  Transferring molybdenum- or tungsten-containing groups
   2.10.1  Molybdenumtransferases or tungstentransferases with sulfide groups as acceptors
    2.10.1.1  molybdopterin molybdotransferase
     BSU14280 (moeA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoeA_N MoCF_biosynth MoeA_C
Motif
Other DBs
NCBI-GeneID: 938797
NCBI-ProteinID: NP_389311
Pasteur: BG12623
BSORF: BG12623
UniProt: O31703
Position
1497192..1498484
Genome map
AA seq 430 aa AA seqDB search
MLEKRTPIPVDEAVRRVCHFQKQGETEWVALEDSLHRFLAEDITADHHVPAFDRSPYDGF
AVRACDTAEASRENPVRFEVIDHIGAGAVSEKELGPFQAVRIMTGAQIPEGADAVVMIEL
TQAFEENGKSFMSLKRRFQTGDNISKTGEDAQKGSVLLTKGTRVTPGVTALLATFGYASV
PVVRKPVVGIIATGTELLNVSDPLEPGKIRNSNASMVYAQAIEAGATPLYLGKISDELDK
SFAAVKEAMKKVDFLITTGGVSVGDFDFLPAIYEKLGADVLFNKVAMRPGSVTTVAHAND
MLLFGLSGNPSACYVGFELFVKPIIQTWLLNETPHSICAEAVLTKDFPKPNPFTRFVRAL
VHHQEGKLLATPVGLDKSSSVTSLADANAFIILPGGTRGYESGRTVQVLLIREENGSEWP
WSVLSRSSKL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgctggagaaaagaacaccgataccggtagacgaggcagttcggcgtgtctgccatttt
caaaaacaaggtgaaacagaatgggtggcgcttgaagacagccttcatcggtttttagcc
gaagatataactgcggatcaccacgtacctgcgtttgaccgttcgccatacgatggtttt
gctgtcagagcgtgcgatacggcagaagcttcacgtgaaaacccagttcggtttgaagtt
attgaccatattggagcgggagcagtatctgaaaaagaacttggcccgtttcaggccgtg
cggattatgactggcgcgcaaatccctgaaggggcagatgcagtcgtcatgattgaactg
actcaagcctttgaggagaatgggaagtcatttatgtctttaaaacgccgctttcagacg
ggggataatatttcaaaaacaggtgaggacgctcaaaaagggagtgttttactgacaaag
ggcacccgggtgacaccaggagtgacggctcttttggcaacattcggatacgcatctgtg
cctgtcgtgagaaagcctgtagtcgggattatcgcaaccggtaccgaattgctgaatgtc
agtgatccgctggaaccgggaaaaatccgcaacagcaatgcgagtatggtatatgcgcaa
gcgatagaagcaggcgcaacaccgctttatttagggaaaatctctgatgaactggataaa
agctttgctgcagttaaagaagcgatgaaaaaggtggacttcctgatcacaactggcggt
gtgtcagtcggtgactttgactttttgcctgcgatctatgaaaaactcggagcggacgtg
ctgtttaataaagttgccatgcgcccgggcagcgtgacaacggtggcgcatgcaaacgat
atgctgctgtttggcctttcaggtaatccgtcggcatgctatgtcggttttgaactgttt
gtcaaaccgataatccagacatggctgctcaatgaaacaccgcattcaatttgtgcggaa
gctgttttgaccaaggattttccgaagccgaacccatttacccgatttgttcgtgcgctc
gtgcaccatcaggaagggaagctgttggcgacacccgttggcttagataagtcgagctct
gtcacatcacttgcagatgccaatgcatttattatcctgccgggcggtacgcgaggctac
gaatctggcagaacggttcaagtgctgctcatcagagaagagaatggaagtgaatggcct
tggtccgtcctttcccgatcgtccaagttgtag

DBGET integrated database retrieval system