KEGG   Bacillus subtilis subsp. subtilis 168: BSU14290Help
Entry
BSU14290          CDS       T00010                                 

Gene name
mobB
Definition
(RefSeq) molybdopterin-guanine dinucleotide biosynthesis adapter protein
  KO
K03753  molybdopterin-guanine dinucleotide biosynthesis adapter protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99987 Cofactor metabolism
    BSU14290 (mobB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MobB MMR_HSR1 cobW Dynamin_N AAA_33 NTPase_1 ATPase_2 AAA_16
Motif
Other DBs
NCBI-GeneID: 938790
NCBI-ProteinID: NP_389312
Pasteur: BG12622
BSORF: BG12622
UniProt: O31704
Position
1498445..1498966
Genome map
AA seq 173 aa AA seqDB search
MALVRPFPIVQVVGFQNSGKTTFIERILEKASEQGVHLGCLKHHGHGGEPQTLTEGKDTD
RYKAAGADVTAVEGAGVLQLTARRNWDLARLIELYQFLETDCLLIEGFKKAPYPKVVILS
EKEDLEALQAVNIIAIIYRKKEHMTEHQGLPVFHADDPVAVDFVLSQLKGESA
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggccttggtccgtcctttcccgatcgtccaagttgtaggatttcaaaacagcgggaaa
acaacgtttattgagcgcattcttgaaaaagcctctgaacagggagtccatttgggctgc
ctgaagcaccatggtcacggcggtgaaccgcaaacgctcacggaaggaaaagacacggac
cgttacaaggcggcaggtgctgatgtaacagcggtagaaggtgctggtgtgttacagctg
actgcccgccgcaattgggatttggcacggctgattgagttataccaatttctcgaaaca
gactgtcttctgattgaaggctttaaaaaagccccttatcctaaagtggttatcctaagt
gaaaaggaagatctggaagcgctgcaagcagtaaatataatcgccatcatctatagaaaa
aaagagcatatgacagagcatcagggattacccgtttttcatgcggatgatccggttgcc
gtggattttgtgctttcacagctgaagggggaatctgcataa

DBGET integrated database retrieval system