KEGG   Bacillus subtilis subsp. subtilis 168: BSU14300Help
Entry
BSU14300          CDS       T00010                                 

Gene name
moaE
Definition
(RefSeq) molybdopterin synthase catalytic subunit
  KO
K03635  molybdopterin synthase catalytic subunit [EC:2.8.1.12]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00790  Folate biosynthesis
bsu01100  Metabolic pathways
bsu04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BSU14300 (moaE)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    BSU14300 (moaE)
Enzymes [BR:bsu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.12  molybdopterin synthase
     BSU14300 (moaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoaE DUF3050
Motif
Other DBs
NCBI-GeneID: 936092
NCBI-ProteinID: NP_389313
Pasteur: BG12620
BSORF: BG12620
UniProt: O31705
Position
1498966..1499439
Genome map
AA seq 157 aa AA seqDB search
MERFEITKTPINTENIIKKVEKREAGAITTFIGTVREWTNGKRTVRLEYEAYEPMAVQML
AQIGAEIEEKWEGASAAITHRIGVLDIGEAAVVIAVSSPHRKAAYEANEYAIERIKQIVP
IWKKEIWEDGEQWIGDQLETTAYPNGKPDLSEGEQHD
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggaacggtttgagattacgaaaacacccattaatactgaaaacatcatcaaaaaagtg
gagaaacgggaagcgggagccattacaacatttattggtacggttcgggaatggacaaac
ggaaaaagaacggttcggcttgaatatgaggcatatgaaccgatggccgtgcaaatgctt
gctcaaatcggcgctgaaatcgaagaaaaatgggaaggtgcctcagctgcgatcacgcac
cgtataggtgtgctcgatatcggtgaagcagcggtagtgattgctgtatcttctccccat
cgaaaagccgcatatgaagccaatgagtatgcgattgaacgcattaaacagattgtgccg
atttggaaaaaagaaatttgggaagacggtgagcaatggatcggcgaccagctagaaacg
acagcttatccgaacggaaaaccagacctaagcgagggagagcagcatgattaa

DBGET integrated database retrieval system