KEGG   Bacillus subtilis subsp. subtilis 168: BSU14320Help
Entry
BSU14320          CDS       T00010                                 

Gene name
yknU
Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K06147  ATP-binding cassette, subfamily B, bacterial
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU14320 (yknU)
Transporters [BR:bsu02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    BSU14320 (yknU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N IstB_IS21 AAA_16 AAA_PrkA AAA_18 RsgA_GTPase Sterol-sensing
Motif
Other DBs
NCBI-GeneID: 938775
NCBI-ProteinID: NP_389315
Pasteur: BG13241
BSORF: BG13241
UniProt: O31707
Position
1499889..1501646
Genome map
AA seq 585 aa AA seqDB search
METFKRLKMYYWPYRKVFMWSLLAMLLMTAITVVYPIILQITIDEIVLGRQYQLAAWVSL
GFIAVMVLKGMATFFHQYLGDMFGIKSVYRLRNGLYEKLQRLSFSYYDNAKTGDLMSRLT
ADVEGLRFFLSYGLAELIRFGLLVAISLSVMFYYSVPLTLVTIAVLPFLAVAVYRFDKRV
HPAFRGIRKSFAKLNTKVQENISGINTVKSLSREDFQISTFNKANAEYRAQYLQTSSIWS
AYFPLMEFIGNTCIVALLSYGGYLVMQNQLNPGELVAFFSLVNYMMWPIMNLGFVINMFS
QAKASGERLLDILEKEEDITDHPHALHKQKLTGDVHFKNVSLAYGKEQTNALCNVSFEAN
SGKVIGLLGPTGSGKSSVTQLLTRFYSPVGGMITIDHKPITDYSLKTLRSNIGVVLQESF
LFSSTIRSNISYGRPDASMEDVIEAAKRAQAHNFIMELPDGYDTMLGERGMGLSGGQKQR
IAIARAICLNPSILILDDATSAVDMQTEHSIQLALKEVMKNRTTFIVAHRISSLKHADEI
LVFNKGRIRERGTHHELLEKGGYYKKIYDLQYRDVKMINEPHEVG
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggagacatttaaaagattaaaaatgtattattggccgtacagaaaagtgtttatgtgg
tcgcttctagccatgcttttgatgactgcaattactgtcgtttatccgattatcctgcaa
attacgattgatgagatcgtactgggacggcagtatcagcttgcggcgtgggtcagctta
ggatttattgcggtgatggttttgaaaggaatggctaccttttttcatcagtatttaggt
gatatgttcgggatcaaatccgtttatcggctgagaaatggtctgtatgaaaaactgcag
cggctttctttttcttactatgataacgcgaaaacaggagatttgatgtccaggctgact
gctgatgttgaagggcttcgttttttcttatcatacggtctcgctgagctcattcgcttc
ggcctgctggtagccatcagcctgtcggttatgttttactattctgttcctctcacgctt
gtgacaatagctgttctgccatttctcgcggttgcggtataccggtttgacaaaagagtc
catcccgccttcagaggcatccgcaaatcgtttgcgaaactcaatacaaaagttcaggaa
aatatcagcggcattaatacggttaaatctctttccagggaagattttcagatcagcact
ttcaataaagccaatgcagaatacagggcgcagtatttacaaacatcatccatttggtct
gcgtatttccctttaatggagttcattggtaacacttgtattgtagctcttctctcatac
ggcggttacttggttatgcaaaatcagctcaatcccggcgagcttgttgctttcttcagc
cttgtcaattatatgatgtggcccattatgaacttaggttttgtcatcaatatgttctct
caagcaaaagcgtcaggggaacgcctgctcgacattctggaaaaagaagaagacattaca
gatcatcctcatgctttgcataaacaaaaattaaccggagatgtccatttcaaaaatgtt
tctcttgcatacggaaaagaacaaacaaacgcgctgtgcaatgtaagctttgaggcaaac
agcgggaaggtaatcggactgttgggcccgacaggttcaggcaaaagctcagtgacacag
cttctcaccagattttacagtcctgttggcggaatgattaccattgatcacaaacccatc
acagattattcgttaaaaacccttcgctccaatatcggggtcgtacttcaagaatccttc
ctgttttcatctacgattagatcaaatatttcgtatgggcggccggatgcctcaatggaa
gacgtcatcgaagcggcaaaaagggcgcaggctcataactttattatggagcttcctgat
gggtatgacaccatgctgggagagaggggaatggggctttccggcgggcagaaacagcgt
attgccattgcgagagccatctgcttgaacccgagcattttaatattggatgatgccaca
agcgcagtagatatgcaaacggagcacagcatacagcttgccttaaaagaagtcatgaaa
aaccgcacaacctttatcgtcgctcaccgcatttcttcactgaaacacgctgatgaaatt
ctcgtttttaataaaggacgcattcgtgaaaggggaacacatcatgagcttcttgaaaaa
ggcggctactataaaaagatttacgatttgcaataccgtgatgtcaaaatgattaatgag
ccgcatgaggtcggatag

DBGET integrated database retrieval system