KEGG   Bacillus subtilis subsp. subtilis 168: BSU14330Help
Entry
BSU14330          CDS       T00010                                 

Gene name
yknV
Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K06147  ATP-binding cassette, subfamily B, bacterial
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU14330 (yknV)
Transporters [BR:bsu02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    BSU14330 (yknV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 AAA_22 AAA AAA_15 T2SSE Zeta_toxin RsgA_GTPase IstB_IS21 AAA_30 AAA_25 AAA_5 AAA_29 Prp19 FAST_2 AAA_23
Motif
Other DBs
NCBI-GeneID: 936087
NCBI-ProteinID: NP_389316
Pasteur: BG13242
BSORF: BG13242
UniProt: O31708
Position
1501658..1503472
Genome map
AA seq 604 aa AA seqDB search
MKQAKKQGVLERFYYSSDEIIEKPFNWAQMWRLLSYVKPYRKTILPLSFLTVLIGTAVKL
VIPILIGVYVLDQAITGRNSELLIQLIFIISGLYVLNYAANVLRIRWMNQLGQHVIYDLR
QHLFTHVQRLSHRFFDQRSAGSILVRIMNDINSLQELFTSGVINLLTDLLLLAGVIIILF
TLSPELTIAIMVTLPIMFFISTSLRKKIRRSWQTVRLKQSKLNSHLNESIQGIRVTQAFT
QEEENMAYFDGVNQENYESWREATRKNAMFRPLVEMTNAIGTAVLIWYGATLIMNETITI
GVFVSFAFYLGMFWEPISRLGQVYNQLLMGMASSERIFEFLDEQPNVKEKPNAIHNEKIN
GEISFEEVEFSYDEKRKALHAVSFSIPAGSTLALVGHTGSGKTTIANLISRFYDAAGGTI
KIDGIPIKDLSLASLRSQISIVLQDTFIFSGTIMENIRFGRPNASDEEVMKASQAVGADE
FISDLAEGYATEVEERGSVLSAGQRQLISFARALLADPAIIILDEATASIDTETEVKIQQ
ALKTLLKGRTAVMIAHRLSTIRDADRIIVLDHGRKIEEGNHDQLLAKGGIYAGLVKAQYS
TAIE
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagcgaaaaaacagggggttttagagcgtttctattactcttcagatgaaatc
attgaaaagccgtttaactgggctcaaatgtggcggctgctgagctatgtcaaaccatat
cgaaaaacaattttgccgctttcttttctcactgtattgattggcactgctgtgaagctt
gtgatccccattttgatcggcgtttatgttcttgatcaagcgattacagggagaaactcg
gagctgctgattcagctcatttttattattagcggtttatatgtcctcaattacgccgcc
aatgtgttaagaatcaggtggatgaatcagcttggccagcatgtcatttacgatttgcga
cagcatttatttacccatgtgcagcgcttatcccatcgattttttgatcagcggtcggcg
ggatcgatcttagtcaggatcatgaatgatattaactctcttcaggagctctttacaagc
ggagtcatcaatttgttgaccgacttgctgcttctggccggcgtgattattattttgttt
acgctgagccctgagctgactatagccatcatggtgacattgccgattatgttttttatt
tcaacaagtctcagaaaaaaaatacgccgatcctggcaaacggtacggctgaagcaatcg
aagctcaactctcatctaaacgaaagcattcagggcatccgggtcacgcaggcatttacg
caggaagaagaaaacatggcgtattttgacggtgtcaatcaggagaactacgaatcatgg
cgggaagcaactagaaaaaatgccatgttccgtccgcttgtagaaatgacgaatgcgatt
gggacggctgtcttgatttggtatggagccacactcatcatgaatgaaaccattacgatt
ggcgtcttcgtttcttttgctttctatctgggaatgttttgggaacctatttcgagactg
ggtcaggtctataatcagctgttaatggggatggcatcatcagaacggatttttgagttt
ctggacgaacagccaaatgtcaaggagaagccgaatgccattcataatgaaaagataaat
ggggagatcagttttgaagaggttgaattttcgtatgatgaaaaacgaaaagcccttcac
gccgtttctttctctattcctgcgggatcgacgcttgcgcttgtcgggcatacagggagc
gggaagacgacgattgccaatttaatcagccgtttttatgatgcggccggaggcaccatt
aaaatagacggtataccgattaaggatctttcccttgccagtctgcgctctcaaatcagc
attgtcctgcaagatacatttattttctccgggaccatcatggaaaatattcgttttgga
aggccaaatgcttcggatgaagaggtgatgaaagcgtcccaagcggtcggagcggatgag
tttatttccgatttagcggaaggatacgcaacagaggtagaggaaaggggcagcgtactg
tctgccggtcagcgccagctcatttcatttgcaagagcattgctcgccgatccggctatt
atcatccttgacgaagcaacggcaagcattgatacagagacagaagtaaaaattcagcaa
gcgttaaaaacgcttctgaaagggcgtacagcagtgatgatcgctcacagattgtctacg
atccgcgacgccgaccgcatcattgttcttgatcacggcaggaaaatagaagaagggaac
catgatcagctgctcgctaaaggaggcatttatgccgggcttgtgaaagcgcaatacagc
acagcgatagaataa

DBGET integrated database retrieval system