KEGG   Bacillus subtilis subsp. subtilis 168: BSU14340Help
Entry
BSU14340          CDS       T00010                                 

Gene name
yknW
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Yip1 DUF1282 DUF2070
Motif
Other DBs
NCBI-GeneID: 938771
NCBI-ProteinID: NP_389317
Pasteur: BG13243
BSORF: BG13243
UniProt: O31709
Position
1503582..1504277
Genome map
AA seq 231 aa AA seqDB search
METNVEKNSGTATEKPSLFGVITSPSVQFERIRERPAVWGPLLIVAAIIIVGAVLQSLGT
DYSELLKSQDTQGLSAEQMETVATITKFGGMAGAIIGGIAALFIAPLIYWLCVKVSGGVT
TYKKMLSLSLFVSLISSLGLLVNGIVAFTTDVNPLYSTTSLAGIIPSDGALASVLNTFEI
FSIWSFVLLAIGLHKTGGISKKAGWISAIILFGILVVFSLFSGLINSVAGA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgaatgtagaaaaaaacagcggaacggcgactgaaaagccttcacttttcgga
gtaatcacaagtccgtccgttcaatttgaaagaataagagaaaggccggctgtatgggga
ccgcttttgattgttgcagcaattatcatcgtcggtgccgtgctgcaatcactcggtacg
gattatagtgagcttttgaaaagccaggatacgcaagggctatctgctgaacaaatggaa
actgtcgcaacaataaccaaatttggcggaatggcaggcgctattatcggcggtatcgca
gcattatttattgcccctcttatttattggctctgtgtaaaagtatcaggcggtgttacg
acatataaaaaaatgctttctctcagtctgtttgtctctttgattagcagtctcggatta
ttggttaatggaatcgttgcttttacgactgacgtgaatcctctttacagcacgacgtca
ctcgcagggattatcccatctgacggggctctcgccagtgtgttaaatacctttgaaatt
ttcagcatctggagctttgtattattagcaatcggacttcacaaaacgggaggcatctca
aaaaaagccgggtggatttcagcaatcattctattcggaattttagttgtattttcgctt
ttttcaggtttaatcaattctgtggcgggtgcataa

DBGET integrated database retrieval system