KEGG   Bacillus subtilis subsp. subtilis 168: BSU14350Help
Entry
BSU14350          CDS       T00010                                 

Gene name
yknX
Definition
(RefSeq) efflux system component YknX
  KO
K02005  HlyD family secretion protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    BSU14350 (yknX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 HlyD_3 Biotin_lipoyl_2 PTS_EIIA_1 Biotin_lipoyl Peptidase_M23 Hen1_Lam_C CemA
Motif
Other DBs
NCBI-GeneID: 938774
NCBI-ProteinID: NP_389318
Pasteur: BG13244
BSORF: BG13244
UniProt: O31710
Position
1504282..1505415
Genome map
AA seq 377 aa AA seqDB search
MKKVWIGIGIAVIVALFVGINIYRSAAPTSGSAGKEVQTGSVEENEISSTVMVPGTLKFS
NEQYVFYEADKGTLEDIKVKEGDKVKKGTALVTYTNEQLSLEKEQNQLTSESNRLQIDQI
QEKLKALDSKERELEKQVGKKEAEKQIESERTELQMQKKTAEIELKQTELQRQSLANRVS
DLEVKSEIEGTVISVNQEAASKKSDIQEPVIHIGNPKDLVVSGKLSEYDTLKVKKGQKVT
LTSDVIQGKTWKGTVSAVGLVPDQQESAAAQGTEQAVQYPLQVKIKGNLPEGKPGFKFIM
NIETDKRKANTLPSKAVKKEDDQYYVYTVKDGKAKRVDVKIGEVTDDLTEIKEGLTQDDQ
VILNPSDQVTDGMEVKS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtctggatcggaattggaatcgcagttatagtcgctctttttgttggaatc
aatatataccggtctgccgctccgacaagcggcagcgccggcaaggaggtacagacgggg
agcgttgaagaaaatgaaatctcatcaacggttatggttcctggcacgctaaaattttca
aatgaacagtatgtcttttatgaagcggataaagggacattagaagacattaaagtaaag
gaaggcgataaagttaaaaagggcacggctttagtcacctatacaaatgagcagctgagc
ctggaaaaagaacagaaccagttaacgtctgaatccaaccggcttcaaattgaccaaatt
caagaaaagttaaaagccttggacagcaaagaaagagaactggaaaaacaggtaggaaag
aaagaagcagaaaaacaaatcgaatctgaacggacagagcttcaaatgcagaaaaaaaca
gcggagatcgaattaaaacaaaccgagcttcagcggcagtcacttgccaaccgggtgtca
gatttagaagtgaaaagcgaaattgaaggcaccgttatttctgtcaaccaagaagcggca
tccaaaaagtcagatattcaagagcctgtcatacatatcggcaacccaaaagaccttgtc
gtctcagggaaattgtctgaatacgatacattgaaagtcaaaaaaggccagaaggtcaca
ctcacttcagatgtaatacagggtaaaacatggaaaggcacggtttccgcagtcgggctt
gttccggatcagcaggagagcgctgcggcacaaggaacagaacaggcggtccaatacccg
cttcaagtgaaaataaaaggaaatcttccagaaggaaagccaggctttaaatttatcatg
aatattgaaacagataaacggaaagcaaatacgcttccttcaaaggcagtcaaaaaagaa
gatgaccaatattatgtgtatacagtaaaagacggaaaagcaaagcgagttgatgtcaaa
atcggcgaagtgacagatgacctgacagaaattaaagaggggcttacccaagatgatcaa
gtcattttgaatccatctgatcaggtgactgacggaatggaagtgaaatcctaa

DBGET integrated database retrieval system