KEGG   Bacillus subtilis subsp. subtilis 168: BSU14380Help
Entry
BSU14380          CDS       T00010                                 

Gene name
fruR
Definition
(RefSeq) DeoR family transcriptional regulator
  KO
K03436  DeoR family transcriptional regulator, fructose operon transcriptional repressor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU14380 (fruR)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Helix-turn-helix
   DeoR family
    BSU14380 (fruR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoRC HTH_DeoR HTH_11 HTH_IclR HTH_12 GntR PaaX MarR HTH_5 RepL HTH_24 Rrf2 DUF2250
Motif
Other DBs
NCBI-GeneID: 936082
NCBI-ProteinID: NP_389321
Pasteur: BG12589
BSORF: BG12589
UniProt: O31713
Position
1507578..1508333
Genome map
AA seq 251 aa AA seqDB search
MLTPERHQLIIDQIEKHDVVKIQELINLTNASESTIRRDLSTLEERGFLKRVHGGAAKLS
DIRLEPDMLEKSSKNLHDKLKIAEKAASLLEEGDCIYLDAGTTTLHMIDFMDKTKDIVVV
TNGVMHIDALIRKEISFYLLGGYVKHRTGAIIGGASLVAMDQYRFDKSFLGTNGVHTEAG
FTTPDPDEALLKQKAIKQAKHAYVLADPSKFGEISFSAFAGIGDATIITTDAEELTFDNY
QEKTVVKVVKP
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgctaactcctgaacggcatcaattgattattgatcaaatagaaaagcatgatgtggta
aagattcaagagcttataaatctgactaatgcttctgaatcaacaatcagaagagattta
tcgacccttgaagaacgcggttttttaaagcgcgttcatggtggagcggccaagctttcc
gatatcagacttgaacccgatatgcttgaaaaatcatccaaaaaccttcacgataaactg
aagattgctgaaaaagctgcttctcttttagaagaaggggattgcatttaccttgatgca
ggcacgacgacattgcacatgattgattttatggataaaaccaaagatattgtcgttgtc
acaaacggggtaatgcatatcgatgcattaataaggaaagaaatttctttttatctgctt
ggaggatacgtaaagcacagaacgggcgcgattattggaggcgcttcattggttgccatg
gaccagtacagatttgacaagagttttctggggacaaacggtgtccatacagaggctgga
tttacaacgccggaccctgatgaggcccttttaaaacagaaagcgatcaaacaggcaaaa
cacgcttacgtcttagcagacccttcgaagttcggagaaatttcattttcggcattcgcc
ggaataggcgacgcaacaatcattacgactgacgctgaagagcttacattcgataattac
caagaaaaaactgtcgtaaaggtagtgaaaccatga

DBGET integrated database retrieval system