KEGG   Bacillus subtilis subsp. subtilis 168: BSU14390Help
Entry
BSU14390          CDS       T00010                                 

Gene name
fruK
Definition
(RefSeq) 1-phosphofructokinase
  KO
K00882  1-phosphofructokinase [EC:2.7.1.56]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00051  Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BSU14390 (fruK)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     BSU14390 (fruK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-GeneID: 938761
NCBI-ProteinID: NP_389322
Pasteur: BG12588
BSORF: BG12588
UniProt: O31714
Position
1508330..1509241
Genome map
AA seq 303 aa AA seqDB search
MIYTVTLNPSVDYIVHVEDFTVGGLNRSSYDTKYPGGKGINVSRLLKRHHVASKALGFVG
GFTGEYIKTFLREENLETAFSEVKGDTRINVKLKTGDETEINGQGPTISDEDFKAFLEQF
QSLQEGDIVVLAGSIPSSLPHDTYEKIAEACKQQNARVVLDISGEALLKATEMKPFLMKP
NHHELGEMFGTAITSVEEAVPYGKKLVEQGAEHVIVSMAGDGALLFTNEAVYFANVPKGK
LVNSVGAGDSVVAGFLAGISKQLPLEEAFRLGVTSGSATAFSEELGTEEFVQQLLPEVKV
TRL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgatttacactgtaacacttaatccatctgtcgattatatagttcacgttgaagatttt
actgtaggaggcctgaaccgttcttcgtatgataccaagtatccagggggcaaaggcatc
aacgtatcgagactgctgaaaagacaccatgtggcgtctaaagcgctcggattcgtcggc
ggatttaccggagaatatatcaaaacatttttacgggaagaaaacctggaaacagctttt
tctgaagtaaaaggggatacccgtatcaatgtaaagctgaaaacgggtgatgaaactgaa
attaacgggcagggaccgacaatttcggatgaagatttcaaagcctttttagaacagttc
caatctttgcaagagggagatatcgttgttcttgcaggaagcattccatcttcactccct
cacgatacttatgaaaaaatcgcagaggcctgcaaacagcagaacgcacgagttgttctg
gatatctcaggcgaggctcttttgaaagcaacagaaatgaaaccatttttgatgaagcca
aatcatcatgagcttggagaaatgttcggcacggccattacatctgttgaggaagccgtt
ccttatgggaaaaagcttgtagaacaaggcgctgaacatgtaatcgtatcaatggccgga
gacggagcgcttctgtttacgaacgaagctgtttattttgctaacgtgccaaaggggaaa
ttggtaaactcagtcggagcaggggattccgttgttgcaggtttccttgccggaatttcc
aaacagctgccgcttgaagaagcattccgcttaggagttacttcaggcagtgctaccgcg
ttctctgaagaacttggaacagaagaatttgtccagcagcttcttcctgaagttaaggtc
acacgtctatag

DBGET integrated database retrieval system