KEGG   Bacillus subtilis subsp. subtilis 168: BSU14400Help
Entry
BSU14400          CDS       T00010                                 

Gene name
fruA
Definition
(RefSeq) PTS system-fructose-specific transporter subunit EIIABC
  KO
K02768  PTS system, fructose-specific IIA component [EC:2.7.1.202]
K02769  PTS system, fructose-specific IIB component [EC:2.7.1.202]
K02770  PTS system, fructose-specific IIC component
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00051  Fructose and mannose metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu02060  Phosphotransferase system (PTS)
Module
bsu_M00273  PTS system, fructose-specific II component
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BSU14400 (fruA)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU14400 (fruA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU14400 (fruA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     BSU14400 (fruA)
Transporters [BR:bsu02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component [MD:M00273]
    BSU14400 (fruA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIA_2 PTS_IIB PTS_EIIC DUF2048 DAO DUF4611
Motif
Other DBs
NCBI-GeneID: 938757
NCBI-ProteinID: NP_389323
Pasteur: BG11938
BSORF: BG11938
UniProt: P71012
Structure
PDB: 

Position
1509256..1511163
Genome map
AA seq 635 aa AA seqDB search
MKITELLTKHTIKLNIESKEKENVIDEMVTVLDKAGKLNDRQAYKEAILNRESQSSTGIG
EGIAIPHAKTASVINPAIAFGRSKDGVDYESLDGQPAHLVFMIAATEGANNTHLEALSRL
STLLMREEIRKQLLEAESEDAIIDIINQHDKDDDEEEEEEEAAPAPAGKGKILAVTACPT
GIAHTFMAADALKEKAKELGVEIKVETNGSSGIKHKLTAQEIEDAPAIIVAADKQVEMER
FKGKRVLQVPVTAGIRRPQELIEKAMNQDAPIYQGSGGGSAASNDDEEAKGKSGSGIGNT
FYKHLMSGVSNMLPFVVGGGILVAISFFWGIHSADPNDPSYNTFAAALNFIGGDNALKLI
VAVLAGFIAMSIADRPGFAPGMVGGFMATQANAGFLGGLIAGFLAGYVVILLKKVFTFIP
QSLDGLKPVLIYPLFGIFITGVLMQFVVNTPVAAFMNFLTNWLESLGTGNLVLMGIILGG
MMAIDMGGPLNKAAFTFGIAMIDAGNYAPHAAIMAGGMVPPLGIALATTIFRNKFTQRDR
EAGITCYFMGAAFVTEGAIPFAAADPLRVIPAAVVGAAVAGGLTEFFRVTLPAPHGGVFV
AFITNHPMLYLLSIVIGAVVMAIILGIVKKPVTEK
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaataactgagcttttaacgaagcatacgataaagcttaatattgagagcaaagaa
aaagaaaatgttattgacgaaatggtcactgttcttgataaggctggaaagttaaatgac
cgacaagcctataaagaagccattttaaatcgcgaaagccaaagctccacgggtatcggt
gaaggaatcgctatcccccatgcgaaaacggcaagcgttatcaacccggcgatcgcgttc
ggacgttcaaaagacggcgtcgattatgaatcattagacggccagccggctcacttagtg
ttcatgatcgcggcgactgaaggcgcaaacaacactcaccttgaagcattgtcaagactt
tcaacgctgttaatgcgtgaagaaatccgtaagcagctccttgaagctgagtctgaagat
gccatcatcgacattattaatcagcacgataaagatgatgacgaagaggaagaggaagaa
gaagcggcaccagcacctgccggaaaagggaaaattttagcggttactgcatgcccgaca
ggtattgcccatacattcatggctgcggatgcccttaaagaaaaagcgaaagagcttggt
gtggaaattaaggtcgaaacaaatgggtcaagcggcattaagcacaagctcactgcccaa
gaaatcgaagatgcacctgcaatcattgtcgcagcggacaagcaggttgaaatggaacgt
tttaaaggcaagcgcgtacttcaagttcctgtaacggcgggtatcagacgtccgcaagag
cttatcgaaaaagcgatgaatcaagatgcgccgatttatcaaggcagcggcggcggttca
gcagcttcaaatgatgatgaagaagcgaaaggcaagtctggaagcggtatcggaaacacg
ttttataagcacctgatgagcggtgtcagcaacatgcttccgttcgtagtcggcggcggt
attctcgttgcgatttcattcttctggggaattcactctgctgatccgaatgatcctagc
tacaacacgtttgcagcagcattaaactttatcggcggcgacaatgcattaaaactcatt
gttgcagttctggccggtttcattgcgatgagtattgcagatcgtcctggttttgcgcct
ggtatggtcggcggatttatggcaactcaagcgaatgctggattcttaggcggcttaatt
gccggattccttgccggttatgtcgtgattttactgaaaaaagtatttacgtttatccct
cagtcacttgatggattaaaacctgttttgatttacccgctgttcggtatttttatcact
ggcgtattaatgcaatttgtcgtcaatacacctgtagcggcatttatgaatttcttaaca
aactggcttgaaagccttggtactggaaaccttgtgttaatgggtattatcttgggcggc
atgatggcgatcgatatgggcggtccgcttaataaagcagcctttacgttcggtatcgcc
atgatcgatgcaggcaactatgcgcctcatgcagcaatcatggccggcggtatggttcct
ccgcttggtatcgcacttgcaacaaccattttcagaaacaaattcactcagcgtgaccgt
gaagctggtattacatgctatttcatgggagctgctttcgtaacagagggagcgatccca
tttgctgcggctgatccgcttcgcgtcataccagctgctgtagtcggtgcagctgttgcc
ggcggattaactgaattcttccgagtaacgcttccggcgcctcatggaggagtattcgta
gctttcattacaaaccatccgatgctttaccttttaagtatcgtgatcggtgctgtcgtg
atggcaattatcctcggtatcgtcaaaaaacctgttacagaaaaataa

DBGET integrated database retrieval system