KEGG   Bacillus subtilis subsp. subtilis 168: BSU14410Help
Entry
BSU14410          CDS       T00010                                 

Gene name
sipT
Definition
(RefSeq) signal peptidase I T
  KO
K03100  signal peptidase I [EC:3.4.21.89]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03060  Protein export
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BSU14410 (sipT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bsu01002]
    BSU14410 (sipT)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     BSU14410 (sipT)
Peptidases [BR:bsu01002]
 Serine Peptidases
  Family S26: signal peptidase I family
   BSU14410 (sipT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S24 Peptidase_S26 AMP-binding
Motif
Other DBs
NCBI-GeneID: 938763
NCBI-ProteinID: NP_389324
Pasteur: BG11977
BSORF: BG11977
UniProt: P71013
Position
1511308..1511889
Genome map
AA seq 193 aa AA seqDB search
MTEEKNTNTEKTAKKKTNTYLEWGKAIVIAVLLALLIRHFLFEPYLVEGSSMYPTLHDGE
RLFVNKTVNYIGELKRGDIVIINGETSKIHYVKRLIGKPGETVQMKDDTLYINGKKVAEP
YLSKNKKEAEKLGVSLTGDFGPVKVPKGKYFVMGDNRLNSMDSRNGLGLIAEDRIVGTSK
FVFFPFNEMRQTK
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgaggaaaaaaatacgaatactgagaaaacggcgaagaaaaaaaccaatacgtac
ctggaatggggtaaagcgattgtcatcgctgttctgctggctctcctgatccgtcacttt
ttgtttgaaccgtatttagttgaaggttcatctatgtatcccacattacatgacggagaa
aggctgtttgtgaataaaacagtcaactatatcggcgagctgaagcgcggagatatcgtt
attatcaacggtgaaacttctaaaatccattatgtaaaaagattgatcggaaagcctgga
gaaaccgttcaaatgaaggatgacacgctttatataaacggtaaaaaagtagccgagcct
tacttgtctaaaaacaagaaggaagcagaaaaacttggtgtcagtctgacaggagacttt
ggaccggttaaggttccgaaaggcaaatactttgtcatgggagataaccggctgaattct
atggacagccgaaacgggctgggactgatcgcggaagatcgaattgtcggcacatcgaag
tttgtctttttcccgtttaacgaaatgcgtcaaacaaaataa

DBGET integrated database retrieval system