KEGG   Bacillus subtilis subsp. subtilis 168: BSU14420Help
Entry
BSU14420          CDS       T00010                                 

Gene name
ykoA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1_like FtsX
Motif
Other DBs
NCBI-GeneID: 938768
NCBI-ProteinID: NP_389325
Pasteur: BG13247
BSORF: BG13247
UniProt: O31715
Position
complement(1511923..1512192)
Genome map
AA seq 89 aa AA seqDB search
MRLLTLTEYCLLIFFTGFYLAVTGFTAKDIGLYIGIALIYIFSHIFSKRLLEKRGKENKQ
VHLFFSVLAIIGSVFITVLCIALVASFSK
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
ttgaggcttttaacacttactgaatattgcttactgatcttttttacgggcttttacctt
gccgtaacaggctttaccgccaaagatatcggcttatatataggcatagcccttatttac
atattttcgcacattttttctaaacggctattagaaaagcgcggaaaagagaacaaacag
gttcaccttttcttcagtgtgctggctattatcggttcagtgttcatcacggttttatgc
attgcattggtcgcttctttttcaaaataa

DBGET integrated database retrieval system