KEGG   Bacillus subtilis subsp. subtilis 168: BSU14430Help
Entry
BSU14430          CDS       T00010                                 

Gene name
ykpA
Definition
(RefSeq) ABC transporter ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_tran_Xtn AAA_21 SMC_N AAA_23 AAA_29 RsgA_GTPase AAA_15 UvrD_C MMR_HSR1
Motif
Other DBs
NCBI-GeneID: 936066
NCBI-ProteinID: NP_389326
Pasteur: BG13270
BSORF: BG13270
UniProt: O31716
Position
1512373..1513995
Genome map
AA seq 540 aa AA seqDB search
MIAVNNVSLRFADRKLFEDVNIKFTPGNCYGLIGANGAGKSTFLKVLSGEIEPQTGDVHM
SPGERLAVLKQNHFEYEEYEVLKVVIMGHKRLYEVMQEKDAIYMKPDFSDEDGIRAAELE
GEFAELNGWEAESEAAILLKGLGISEDLHTKKMADLGGSEKVKVLLAQALFGKPDVLLLD
EPTNHLDLQAIQWLEEFLINFENTVIVVSHDRHFLNKVCTHIADLDFNKIQIYVGNYDFW
YESSQLALKLSQEANKKKEEQIKQLQEFVARFSANASKSKQATSRKKLLEKITLDDIKPS
SRRYPYVNFTPEREIGNDVLRVEGLTKTIDGVKVLDNVSFIMNREDKIAFTGRNELAVTT
LFKIISGEMEADSGTFKWGVTTSQAYFPKDNSEYFEGSDLNLVDWLRQYSPHDQSESFLR
GFLGRMLFSGEEVHKKANVLSGGEKVRCMLSKAMLSGANILILDEPTNHLDLESITALNN
GLISFKGAMLFTSHDHQFVQTIANRIIEITPNGIVDKQMSYDEFLENADVQKKLTELYAE
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgattgctgtaaataatgtaagcttgcggtttgcggatcgcaagttatttgaagatgtt
aatattaaatttaccccaggcaactgctatgggttaattggtgcaaacggtgccggtaaa
tcaacgtttctaaaggtgctgtcaggcgaaatcgagcctcagacaggcgacgtgcatatg
agtcctggcgagcgtcttgccgtcttgaagcagaaccattttgagtacgaagagtatgaa
gtgctgaaagtggtcattatgggccacaaacgcctgtatgaagtcatgcaggagaaagac
gctatttacatgaagcctgatttctcagatgaggatgggattcgtgctgctgagctagaa
ggtgaattcgcggaactgaacggttgggaagcggaaagtgaagctgcgatcctgttaaaa
ggccttggtatctcagaagatctgcacacaaaaaagatggcagacctcggcggttcggag
aaggtaaaagttctcttggcacaggcattattcggcaagccggatgttctgctgctcgat
gagccgacgaaccacctggaccttcaggcaattcagtggcttgaagagtttctgattaac
tttgaaaacacagttattgtcgtatcccatgaccgtcactttttaaataaagtatgtacg
cacattgccgaccttgattttaacaaaattcaaatctatgtcggaaactatgatttctgg
tacgagtcaagccagctggcgttaaagctttctcaagaagcgaacaagaaaaaagaagag
cagattaaacagcttcaagagtttgtcgctagattcagcgccaatgcgtctaaatctaag
caggctacatcaagaaagaaacttctcgaaaaaatcacgctggatgatattaaaccgtct
tcccgccgctatccttatgttaacttcacgccggaacgggaaatcggaaatgatgttctt
cgcgtggaaggcttaacaaaaacaatcgatggcgtaaaggtgcttgacaatgtcagcttt
attatgaatcgagaagataaaattgctttcactggccgaaatgaacttgctgttactacg
ctgtttaaaatcatttccggggaaatggaagctgacagcggaacgtttaaatggggtgtt
accacatctcaagcgtattttccaaaagacaacagcgaatatttcgaaggcagtgatctg
aaccttgtagactggcttcgccaatattctccgcacgaccaaagtgagagctttttacgc
ggtttcttaggacgcatgctgttctctggagaagaagtccacaaaaaagcaaatgtactt
tccgggggagaaaaggtccgctgtatgctgtcgaaagcgatgctttctggcgccaatatt
ttaattttggatgagccgaccaaccatttagacctagagtccattacagcgctcaataac
ggcttaatcagctttaaaggcgctatgctgtttacttcccatgaccatcagtttgtgcag
accattgccaacagaattatagaaattacacctaacggcatcgtcgataagcaaatgagc
tatgacgagttccttgaaaatgctgatgtgcagaaaaaattgactgaactatacgccgaa
taa

DBGET integrated database retrieval system