KEGG   Bacillus subtilis subsp. subtilis 168: BSU14440Help
Entry
BSU14440          CDS       T00010                                 

Gene name
ykpB
Definition
(RefSeq) oxidoreductase
  KO
K00077  2-dehydropantoate 2-reductase [EC:1.1.1.169]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00770  Pantothenate and CoA biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSU14440 (ykpB)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.169  2-dehydropantoate 2-reductase
     BSU14440 (ykpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ApbA ApbA_C F420_oxidored TrkA_N Epimerase
Motif
Other DBs
NCBI-GeneID: 938752
NCBI-ProteinID: NP_389327
Pasteur: BG13271
BSORF: BG13271
UniProt: O31717
Position
1514052..1514963
Genome map
AA seq 303 aa AA seqDB search
MKFLVVGAGGVGGYIGGRLSEKGNDVTFLVRQKRAEQLKKTGLVIHSEKGNVSFQPELIS
AGETGQFDVVIIASKAYSLGQVIEDVKPFIHQESVIIPFLNGYRHYEQLFAAFSKEQVLG
GLCFIESALDNKGEIHHTSASHRFVFGEWNGERTERIRALEEAFSGVKAEVIISGHIEKD
IWKKYLFIAAQAGITTLFQRPLGPILATEAGRHTAQTLIGEICTVLRKEGVPADPALEEE
SFRTMTSMSYHMKSSMLRDMENGQTTEGDHLHGFLIEKAKRLSLAAPVLETVYANLQMYE
AEK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttttggttgtcggagcaggtggagtaggcgggtatattggcggacggctttcg
gagaaaggaaatgatgtgacatttctcgtgcgccaaaaacgagctgagcagcttaaaaaa
accgggcttgtcatccatagtgaaaaagggaatgtatcatttcagcccgaactaatcagt
gccggagaaacagggcaatttgatgtcgttatcattgcttctaaagcatactcgcttggt
caagtgatagaggatgtcaaaccatttatccatcaagaatctgtcattatccctttttta
aatgggtaccgccactatgagcagctatttgcggcattttcaaaagaacaggtgctgggc
ggcctgtgttttatagaaagtgctttagacaacaaaggagaaattcatcatacgagcgca
tcgcatcgttttgtatttggagaatggaacggcgagcgtacggagcggataagagcgctt
gaagaggcattttcaggtgtgaaggctgaagtcatcattagcgggcatatcgagaaggac
atttggaaaaagtatctctttattgcagcgcaagcggggatcacaacgttatttcaacga
ccgcttggcccaatcctcgccacagaagccggacgtcacacggcccaaactcttattggg
gaaatttgcactgttttacgaaaagaaggtgttccggctgatccggctcttgaggaagag
agctttcgtacgatgaccagcatgtcttaccatatgaagtcctccatgcttcgggatatg
gaaaacggccaaacgacagaaggcgaccacctgcatggatttttgattgaaaaagcaaaa
cgtttatctctcgctgcaccagtattagaaaccgtttatgcgaatctgcaaatgtatgaa
gcagaaaaataa

DBGET integrated database retrieval system