KEGG   Bacillus subtilis subsp. subtilis 168: BSU14450Help
Entry
BSU14450          CDS       T00010                                 

Gene name
ampS
Definition
(RefSeq) aminopeptidase AmpS
  KO
K19689  aminopeptidase [EC:3.4.11.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bsu01002]
    BSU14450 (ampS)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     BSU14450 (ampS)
Peptidases [BR:bsu01002]
 Metallo Peptidases
  Family M29: aminopeptidase T family
   BSU14450 (ampS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M29
Motif
Other DBs
NCBI-GeneID: 938756
NCBI-ProteinID: NP_389328
Pasteur: BG10986
BSORF: BG10986
UniProt: P39762
Position
complement(1514997..1516229)
Genome map
AA seq 410 aa AA seqDB search
MDSFSQKLNTYAQLAVEVGVNVQKGQYVVVNASTDVRDFVRLIVKHAYEKGAKNVTVNWQ
DDEVAKLKYELAPFEAFEEYPEWEAKGREELAKNGAAFISVVSSNPDLLKGIDSKRIAAF
QKAAGKALHTYRQYIQSDKVSWTVVGAASAGWAHKVFPGKSEEEAIHLLWEEIFKATRVN
EDNPVQAWINHDQNLHEKVDHLNERHYAALHYQAEGTDLTIKLPRKHVWAGAGSVNESGH
EFMANMPTEEVFTLPQKDGVDGVVSSTKPLSYGGNIIENFTLTFENGRIVDIKAEKGEDI
LKELVETDEGSHYLGEVALVPYDSPISQSNILFYNTLFDENASNHLAIGSAYAFNIEGGK
QMSREELVKEGLNESITHVDFMIGSKDMNIDGITADGKREPIFRNGNWAF
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggattcattttcacagaaattaaatacatatgcacagctggcggtagaagtcggcgtt
aatgtccaaaaaggccagtatgtagtcgtaaatgcttcaacagacgttcgggattttgtc
cgtttaattgtaaaacacgcatatgaaaagggcgcaaaaaacgtcaccgtgaattggcag
gatgacgaagtcgccaaattaaaatacgaacttgcgccgtttgaagcatttgaagaatat
cctgaatgggaagcaaaaggcagagaagagcttgccaaaaatggagctgctttcatttct
gttgtgtcgtcgaacccagacttgctaaaaggtatagattccaaacggattgcggcattc
caaaaagcagcaggcaaagcattacatacatacagacaatatattcaatcagacaaagtc
agctggactgtcgtaggtgcggcatcagcaggctgggctcacaaggtgtttcctggcaaa
tcagaggaggaagcgatccaccttctgtgggaagaaatttttaaagcgacgcgcgtaaat
gaagacaacccggttcaggcgtggatcaatcatgaccaaaatcttcatgaaaaagttgac
catttgaacgagagacattacgctgccttacattatcaagcagaaggaactgatctaaca
attaagctgcctaggaagcatgtttgggcaggtgcgggaagcgtgaatgaaagtggccat
gagtttatggccaatatgccgacagaagaagtgttcacgctgccgcaaaaagacggggtt
gacggagtggtatcaagcacaaaaccattaagctacggcggaaatattattgaaaatttc
accctgacgtttgaaaatggccgtatagtcgacattaaagctgaaaaaggtgaggatatt
ttaaaagaactggtggaaacagatgaaggttctcactatttaggtgaagtggcacttgtt
ccttacgattcgcctatatcacaatcaaacattcttttctataacacgctgtttgatgaa
aacgcgtcaaatcatttggcgatcggaagcgcctatgcctttaatattgaaggcggaaag
cagatgtctcgtgaagagcttgtcaaagaaggcctaaatgaaagcattacacacgtggac
tttatgatcggttctaaggatatgaatattgacggaattacggcagacgggaaaagagag
cctatcttcagaaacggaaattgggctttttaa

DBGET integrated database retrieval system