KEGG   Bacillus subtilis subsp. subtilis 168: BSU14470Help
Entry
BSU14470          CDS       T00010                                 

Gene name
mreBH
Definition
(RefSeq) rod-share determining protein MreBH
  KO
K03569  rod shape-determining protein MreB and related proteins
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU14470 (mreBH)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bsu04812]
    BSU14470 (mreBH)
   02048 Prokaryotic defense system [BR:bsu02048]
    BSU14470 (mreBH)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BSU14470 (mreBH)
Cytoskeleton proteins [BR:bsu04812]
 Prokaryotic cytoskeleton proteins
  Actin homologs
   Actins
    BSU14470 (mreBH)
Prokaryotic defense system [BR:bsu02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    BSU14470 (mreBH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MreB_Mbl HSP70 Actin FtsA PilM_2 Ppx-GppA EutA
Motif
Other DBs
NCBI-GeneID: 938746
NCBI-ProteinID: NP_389330
Pasteur: BG10987
BSORF: BG10987
UniProt: P39763
Position
complement(1516574..1517581)
Genome map
AA seq 335 aa AA seqDB search
MFQSTEIGIDLGTANILVYSKNKGIILNEPSVVAVDTTTKAVLAIGADAKNMIGKTPGKI
VAVRPMKDGVIADYDMTTDLLKHIMKKAAKSIGMSFRKPNVVVCTPSGSTAVERRAISDA
VKNCGAKNVHLIEEPVAAAIGADLPVDEPVANVVVDIGGGTTEVAIISFGGVVSCHSIRI
GGDQLDEDIVSFVRKKYNLLIGERTAEQVKMEIGHALIEHIPEAMEIRGRDLVTGLPKTI
MLQSNEIQDAMRESLLHILEAIRATLEDCPPELSGDIVDRGVILTGGGALLNGIKEWLTE
EIVVPVHVAQNPLESVAIGTGRSLEVIDKLQKAIK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaatcaactgaaatcgggattgacttaggaacagctaatatacttgtttacagc
aaaaataaagggattatcctaaatgaaccatctgttgtcgcagtggatacgacgacaaaa
gcagtgcttgcaatcggagctgacgcgaaaaacatgatcggtaaaacaccgggaaaaatt
gtcgctgtcagaccgatgaaagatggcgtgatcgcagactatgatatgacaactgacctg
ctaaagcacattatgaaaaaagccgcaaaaagcatcggcatgtcgttcagaaaaccgaac
gtagtcgtttgcacaccatcaggctcaacagcagtagaacgccgcgccatcagtgatgcg
gtgaaaaattgcggcgcgaaaaacgttcatttaatcgaagagccagttgcagccgccatc
ggagcggatttaccggttgatgagccggttgccaatgtggtagtagatatcggcggaggg
acgacagaggtcgctattatttccttcggtggcgttgtttcctgccattctatcaggatc
ggcggagaccagcttgatgaggatatcgtttctttcgtccgtaaaaaatacaatttgctg
atcggcgaacgcacagctgagcaggtaaaaatggaaattggccatgctctgattgaacat
ataccagaggcaatggaaattcggggacgtgacctcgtgacaggtcttccaaaaaccatt
atgcttcaatccaacgaaattcaagatgcaatgcgtgaatccctcctgcatattcttgaa
gccatcagagcgacacttgaggactgtccgcctgaattgagcggagatattgttgatcgc
ggcgttattttaacaggcggcggcgcgctccttaatggaattaaagaatggctcacagaa
gagattgtcgtgcctgtacacgtggcgcaaaacccgcttgaatctgtagcaatcggcaca
ggccgttctttagaagtgattgataagctgcaaaaggcaattaaatag

DBGET integrated database retrieval system