KEGG   Bacillus subtilis subsp. subtilis 168: BSU14480Help
Entry
BSU14480          CDS       T00010                                 

Gene name
abh
Definition
(RefSeq) transition state regulator Abh
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AbrB_C MazE_antitoxin
Motif
Other DBs
NCBI-GeneID: 938738
NCBI-ProteinID: NP_389331
Pasteur: BG10988
BSORF: BG10988
UniProt: P39758
Structure
PDB: 

Position
1517865..1518143
Genome map
AA seq 92 aa AA seqDB search
MKSIGVVRKVDELGRIVMPIELRRALDIAIKDSIEFFVDGDKIILKKYKPHGVCLMTGEI
TSENKEYGNGKITLSPEGAQLLLEEIQAALKE
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaataggtgttgtgagaaaagtagatgaattaggccgcattgtcatgccgatt
gagttgagacgggcattggatattgccataaaagacagcattgagttttttgttgacgga
gataaaattatcttgaaaaagtacaaacctcatggcgtttgtttaatgactggagaaatc
acttcagaaaataaagaatacggcaacggtaaaattacgctaagccctgagggtgcacag
ctgcttctcgaagaaattcaagccgctttaaaagaataa

DBGET integrated database retrieval system