KEGG   Bacillus subtilis subsp. subtilis 168: BSU14500Help
Entry
BSU14500          CDS       T00010                                 

Gene name
ykqA
Definition
(RefSeq) gamma-glutamylcyclotransferase YkqA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GGACT AIG2_2 ChaC
Motif
Other DBs
NCBI-GeneID: 939408
NCBI-ProteinID: NP_389333
Pasteur: BG10990
BSORF: BG10990
UniProt: P39759
Structure
PDB: 

Position
1519635..1520468
Genome map
AA seq 277 aa AA seqDB search
MNSLLFVYGTLRKHEKNHHLLAQSACINEQARTKGSLFAAKEGPTVVFNDEDEGYIYGEV
YEADELCIHKLDQFFQGYHKQTVFVETDVGIKIALIYFMNKDGCAGFTKISSGDWKEHQM
ISKSKNPIYYFAYGSCMDNARFQKAGVDHYFQDPVGRAVLKGYTTRFTLKREDGSRADML
EDGGTTEGVLYRIPYSALSYLYKREGVESLTYRPAFVDVEAGGRHYKDCLTFLVLQKEAE
IAPPQHYQIEIERGAELYLSPEFTEKLKRHMNSLPKG
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgaactcgcttctgtttgtatacgggacattaagaaagcatgaaaaaaaccatcatttg
ctggcacaatcggcatgtatcaatgagcaggcgagaacaaagggaagtttgtttgctgca
aaagaggggcccacagttgttttcaatgatgaagatgaaggctatatatatggcgaagta
tatgaagcagatgaattgtgtatacataagctcgatcaattttttcaaggatatcataaa
caaacggtgtttgtagaaacggatgtcgggattaaaattgcgcttatttattttatgaac
aaagacgggtgtgccggttttacgaaaataagcagcggcgactggaaagaacatcagatg
atcagcaaatcgaaaaatcccatttattattttgcctatggatcatgcatggataatgcc
cgctttcaaaaagcgggagtcgatcactattttcaagatccagtaggaagagctgtttta
aaaggatacacaacccgcttcacgctaaaaagggaagacggttcaagagcggacatgttg
gaagacggaggaacaacagaaggcgttttataccgtatcccttattctgctctctcctat
ctatataaaagggagggcgtcgaatctcttacgtatcggccggcatttgtagacgttgaa
gctggcggaaggcactacaaagactgtttaacctttctcgtcctccaaaaagaagcggaa
attgccccgcctcagcactatcagattgaaatcgaacgcggagcggagctgtatttgtcg
cctgagtttactgaaaagctcaagcggcatatgaattcgctgccaaaaggataa

DBGET integrated database retrieval system