KEGG   Bacillus subtilis subsp. subtilis 168: BSU14510Help
Entry
BSU14510          CDS       T00010                                 

Gene name
ktrC
Definition
(RefSeq) ktr system potassium uptake protein C
  KO
K03499  trk system potassium uptake protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU14510 (ktrC)
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU14510 (ktrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkA_N TrkA_C ADH_zinc_N NAD_binding_2 UDPG_MGDP_dh_N 3HCDH_N F420_oxidored UPF0146 Epimerase 2-Hacid_dh_C adh_short NAD_Gly3P_dh_N IlvN Shikimate_DH ApbA
Motif
Other DBs
NCBI-GeneID: 939429
NCBI-ProteinID: NP_389334
Pasteur: BG10991
BSORF: BG10991
UniProt: P39760
Position
1520531..1521196
Genome map
AA seq 221 aa AA seqDB search
MKKEFAVIGLGRFGGSICKALSEEGVEVMAMDIDEDKVNEYAKIASHAVIGDSTDESVLK
NLGLRNFDHVIVAIGENIQASILTTLILKELGVHTITVKAQNDYHEKVLSKIGADHIVHP
ERDMAKRIAHNIVSNNVLDYLELSEEHSLVEIVANSRLAGNTLLDLDIRAKYGINIVAIK
RGKEVIVSPLATEVIHQEDILIVIGSVTDISRFEKRVLHTK
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaatttgcggtaattgggctgggccgttttggtggcagtatttgcaaagca
ttaagcgaagaaggcgtcgaggttatggcaatggatatcgatgaagataaagtcaacgag
tatgccaagattgcatctcacgcagttatcggtgattcgacagacgaatctgtcctgaaa
aatttaggcctgcgaaattttgaccacgttattgtagcaatcggggaaaatattcaagcg
agtattttaacgacactcattctgaaagaacttggcgtccatacgattacagttaaagcg
cagaacgattatcacgaaaaagtgctgtctaaaattggtgcggatcacatcgtccacccg
gaacgcgatatggcaaaacgaattgcgcataatatcgtgtccaacaatgtacttgactat
ttggagctgtctgaagagcatagtcttgttgaaatcgtagctaacagccgcctggctgga
aatacgcttctcgatttagatattcgcgcaaaatacggtattaacatcgtagccataaaa
aggggcaaggaagtcatcgtatcaccgcttgcaaccgaagtcatccaccaagaagatata
ctcattgttattggatcagttacagacatctcccgtttcgaaaaaagagttcttcataca
aaatag

DBGET integrated database retrieval system