KEGG   Bacillus subtilis subsp. subtilis 168: BSU14530Help
Entry
BSU14530          CDS       T00010                                 

Gene name
rnjA
Definition
(RefSeq) ribonuclease J 1
  KO
K12574  ribonuclease J [EC:3.1.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BSU14530 (rnjA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bsu03019]
    BSU14530 (rnjA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     BSU14530 (rnjA)
Messenger RNA biogenesis [BR:bsu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     BSU14530 (rnjA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_J_C Lactamase_B Lactamase_B_2 RMMBL SIS_2
Motif
Other DBs
NCBI-GeneID: 939483
NCBI-ProteinID: NP_389336
Pasteur: BG11813
BSORF: BG11813
UniProt: Q45493
Structure
PDB: 

Position
complement(1523118..1524785)
Genome map
AA seq 555 aa AA seqDB search
MKFVKNDQTAVFALGGLGEIGKNTYAVQFQDEIVLIDAGIKFPEDELLGIDYVIPDYTYL
VKNEDKIKGLFITHGHEDHIGGIPYLLRQVNIPVYGGKLAIGLLRNKLEEHGLLRQTKLN
IIGEDDIVKFRKTAVSFFRTTHSIPDSYGIVVKTPPGNIVHTGDFKFDFTPVGEPANLTK
MAEIGKEGVLCLLSDSTNSENPEFTMSERRVGESIHDIFRKVDGRIIFATFASNIHRLQQ
VIEAAVQNGRKVAVFGRSMESAIEIGQTLGYINCPKNTFIEHNEINRMPANKVTILCTGS
QGEPMAALSRIANGTHRQISINPGDTVVFSSSPIPGNTISVSRTINQLYRAGAEVIHGPL
NDIHTSGHGGQEEQKLMLRLIKPKFFMPIHGEYRMQKMHVKLATDCGIPEENCFIMDNGE
VLALKGDEASVAGKIPSGSVYIDGSGIGDIGNIVLRDRRILSEEGLVIVVVSIDMDDFKI
SAGPDLISRGFVYMRESGDLINDAQELISNHLQKVMERKTTQWSEIKNEITDTLAPFLYE
KTKRRPMILPIIMEV
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgtaaaaaatgatcagactgctgttttcgccctcggaggtttgggcgaaatc
ggtaaaaatacgtacgcggtgcaattccaggatgaaattgtactgattgatgcggggatc
aagtttcccgaggacgaactgctcggaattgactacgtcatccctgattatacgtattta
gtcaaaaacgaagataaaattaaagggctttttatcacccacgggcacgaagaccacatc
ggcggtattccatacctgctcagacaagtgaatattcctgtatacggcggaaaactcgcg
atcggcttacttcggaataaacttgaagagcatggattattgagacagacgaaactgaac
attatcggcgaggatgatattgtaaagttccgcaaaacggctgtgtcattcttcagaaca
acacacagtattccggattcctacggcattgttgtaaaaacgccgcccggaaacatcgta
catactggggatttcaaattcgactttactccagtcggcgagccggcaaacttaacgaaa
atggccgaaatcggtaaagaaggcgttttgtgccttctttcagacagcacaaacagtgaa
aatccggagtttaccatgtctgagcgccgtgtaggagaaagcattcatgacattttccgc
aaggtggacggccgaattatcttcgccacatttgcgtcgaatattcaccgcttgcagcag
gtaattgaagctgctgtacaaaatggaagaaaagttgccgtatttggacgcagtatggaa
tcggctatcgaaattggacagacactcggttatattaactgtcctaaaaatacgtttatt
gagcataacgaaatcaatcgtatgcctgctaataaagtaacaattttatgtacaggaagc
caaggggaaccaatggcggcgttatcaagaattgcaaacggcacacaccgccaaatttca
atcaatcctggggatacagtcgtattttcttcatcccctatcccaggcaacacaatcagc
gtgagtcgaacaatcaaccagctgtatcgtgcgggtgctgaggttattcacggccctctt
aacgatatccatacatccggtcacggcggacaggaagaacagaagctgatgcttcgttta
atcaagcctaaattcttcatgccgattcacggtgagtacagaatgcaaaagatgcatgtc
aaacttgcaacagattgtggcatcccagaggaaaactgctttatcatggataatggtgaa
gtattagcacttaaaggcgatgaggcttcagttgcaggaaaaatcccgtccggttcagtg
tacattgacggaagcggtatcggtgatattggcaatatcgtacttcgtgatcgcagaatt
ctctctgaagaaggacttgtcatcgttgttgtcagcattgacatggacgacttcaagatt
tcagcgggtcctgatttgatttccagaggatttgtgtacatgagagaatctggtgacttg
atcaacgacgctcaagagctcatttcaaatcacttacaaaaagtaatggaacgaaaaacg
actcaatggtctgaaatcaaaaacgaaattacagacacgcttgcacctttcttgtacgaa
aaaacaaagcgccgtccaatgatcctgccgatcattatggaggtttaa

DBGET integrated database retrieval system