KEGG   Bacillus subtilis subsp. subtilis 168: BSU14540Help
Entry
BSU14540          CDS       T00010                                 

Gene name
ykzG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1447
Motif
Other DBs
NCBI-GeneID: 939482
NCBI-ProteinID: NP_389337
Pasteur: BG13335
BSORF: BG13335
UniProt: O31718
Position
complement(1524791..1525000)
Genome map
AA seq 69 aa AA seqDB search
MIYKVFYQEKADEVPVREKTDSLYIEGVSERDVRTKLKEKKFNIEFITPVDGAFLEYEQQ
SENFKVLEL
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atgatttataaggtattttatcaagagaaggctgacgaagtacctgttcgggaaaagaca
gattcactttatattgaaggcgtatctgagcgtgacgtcagaacaaagctgaaagaaaag
aaatttaatattgagtttattacacctgttgatggtgcattcttagaatatgaacaacag
agcgaaaattttaaagtattggagttatga

DBGET integrated database retrieval system