KEGG   Bacillus subtilis subsp. subtilis 168: BSU14550Help
Entry
BSU14550          CDS       T00010                                 

Gene name
ykrA
Definition
(RefSeq) phosphatase YkrA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 Hydrolase HAD S6PP HAD_2 Hydrolase_6
Motif
Other DBs
NCBI-GeneID: 939479
NCBI-ProteinID: NP_389338
Pasteur: BG11814
BSORF: BG11814
UniProt: Q45494
Position
1525386..1526159
Genome map
AA seq 257 aa AA seqDB search
MDSKLIFFDIDGTIYDHDKNIPESTRKTVAELQRQGHHVFIASGRSPFLVKPILEELGIH
SFISYNGQFVVFENQVIYKNPLPENAIRRLLKQADEGKHPVVFMAEDTMKATVADHPHVL
EGIGSLKTDYPETDDLFYEGKEIFQLLLFCQDEEEKAYAAFPEFDLVRWHELSTDVLPHG
GSKAEGIKKVIERLPFDIGDTYAFGDGLNDLQMIEYVGTGVAMGNAVPELKEIADFVTKP
VDEDGIAYAVKELGLLK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggattctaaattaatcttttttgatattgacggcacaatatatgatcatgataagaat
ataccggaaagtacgagaaaaaccgtggcggagcttcagcgccaagggcatcatgtgttt
attgccagcggccggtctccatttttggttaagccgattttggaggagctgggcatccac
tcatttatttcctacaatggacagtttgttgtctttgaaaatcaagtgatttataaaaat
ccgctgcctgaaaatgcaatcaggcgattattaaagcaggcggatgaaggcaagcatcct
gttgtgtttatggctgaggacacgatgaaagcgactgttgcggatcacccccatgttctc
gagggaatcggcagccttaaaacagattatccagagaccgatgaccttttttatgaagga
aaagaaatttttcagcttcttttattttgtcaggatgaagaagaaaaagcttatgccgct
tttcctgagtttgatctagttcgctggcatgagctatcgactgatgttctgccgcacgga
ggttcgaaggcagaaggaatcaaaaaagtgattgagcgtcttccgtttgatatcggcgat
acatatgctttcggcgacggattaaatgatttgcaaatgattgaatacgttgggacaggc
gttgctatgggaaatgctgttcccgaactgaaagaaatcgcggactttgtaacaaaaccg
gtggacgaggatggaattgcatacgctgtcaaagaattgggccttttaaaataa

DBGET integrated database retrieval system