KEGG   Bacillus subtilis subsp. subtilis 168: BSU14560Help
Entry
BSU14560          CDS       T00010                                 

Gene name
def
Definition
(RefSeq) peptide deformylase
  KO
K01462  peptide deformylase [EC:3.5.1.88]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU14560 (def)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.88  peptide deformylase
     BSU14560 (def)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pep_deformylase
Motif
Other DBs
NCBI-GeneID: 939491
NCBI-ProteinID: NP_389339
Pasteur: BG11815
BSORF: BG11815
UniProt: Q45495
Position
complement(1526195..1526749)
Genome map
AA seq 184 aa AA seqDB search
MITMENIVRDGHPALRETAEPVELPPTDAEKQQLADMIEFVKNSQNPELAEKYKLRPGVG
LAAPQINIKKRMIAVHAEDASGKLYSYALFNPKIVSHSVEKSYLTSGEGCLSVDEAIPGY
VPRYARIRVKGTTLEGENIDIRLKGFPAIVFQHEIDHLNGVMFYDHIDKENPFKEPENAI
AIER
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
ttgattactatggaaaacatcgtacgtgacggccatccagccctcagagagactgccgaa
cctgttgagctgcctccaactgatgcagaaaaacagcagctggccgacatgatcgaattt
gttaaaaacagccaaaatccagaattagccgaaaaatacaagctgcgccctggcgtagga
ctcgcagctcctcaaattaatatcaaaaaacgaatgatcgccgttcatgcggaagatgct
tccggtaaattatacagctatgctctgtttaatcctaagatcgtcagccattcagttgaa
aaaagctacttaacaagcggcgagggctgcctctctgtggatgaagcgattcccggttat
gttccccgctatgctcgcatcagagtaaaaggaacaacactagaaggcgaaaatattgat
attcgtttaaaaggatttccggctattgtgtttcagcatgagatcgatcatttgaacggc
gttatgttctatgatcatattgataaggaaaatcctttcaaagaacctgaaaatgcaatc
gcaattgagcgctaa

DBGET integrated database retrieval system