KEGG   Bacillus subtilis subsp. subtilis 168: BSU14570Help
Entry
BSU14570          CDS       T00010                                 

Gene name
ykyA
Definition
(RefSeq) lipoprotein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YkyA DUF3450
Motif
Other DBs
NCBI-GeneID: 939487
NCBI-ProteinID: NP_389340
Pasteur: BG10206
BSORF: BG10206
UniProt: P21884
Position
1527231..1527902
Genome map
AA seq 223 aa AA seqDB search
MKDAIKRRPGIKIGAFCAMALILTGCMGQDPVDSLHHSLEKAAESEKPFQEEQNTLKELE
AKENQLYDSVMKLNMDDYKKIVALSNKALENVSKREEHLKLENDSMKKSETEFEEAKTSA
EHIKEKDIKEKADAAANHMEKRYTSYGTMYKEYKKALELNKKLYMQLKDKDLTRDDLDQQ
IDKVNASYEKILKYSGEFNEQTEKYNKAREDLYDAAGYRVKKS
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagacgctataaaacggcggcctggaatcaagatcggagctttttgtgccatggca
ctgatattaacaggatgcatgggacaggacccggttgattcacttcatcattcattagaa
aaagccgcggaatcggaaaagccgtttcaagaagaacaaaacacactcaaagaattagag
gccaaagaaaatcagctttacgatagtgttatgaagctcaatatggatgattataaaaaa
attgttgctttatctaataaggcgcttgaaaatgtcagcaagcgcgaagaacacctaaag
cttgaaaatgacagcatgaaaaaatcggaaacagaatttgaggaagcaaaaacgtcagcg
gaacatattaaggaaaaagacataaaagaaaaggccgatgccgcagcaaaccatatggag
aaaagatatacatcatatggcactatgtataaagagtataaaaaagcgcttgagcttaat
aaaaaactgtatatgcagctgaaagacaaagatttgacaagagatgatctggatcagcag
atcgataaagtcaatgcttcttatgaaaagatccttaaatatagcggagaatttaatgaa
caaaccgaaaaatataataaagcccgggaagatttatatgatgctgcaggctatcgtgtg
aaaaagagctga

DBGET integrated database retrieval system