KEGG   Bacillus subtilis subsp. subtilis 168: BSU14580Help
Entry
BSU14580          CDS       T00010                                 

Gene name
pdhA
Definition
(RefSeq) pyruvate dehydrogenase E1 component subunit alpha
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00020  Citrate cycle (TCA cycle)
bsu00620  Pyruvate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01130  Biosynthesis of antibiotics
bsu01200  Carbon metabolism
Module
bsu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU14580 (pdhA)
   00020 Citrate cycle (TCA cycle)
    BSU14580 (pdhA)
   00620 Pyruvate metabolism
    BSU14580 (pdhA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     BSU14580 (pdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh DXP_synthase_N TPP_enzyme_C RNase_J_C Glyoxalase_5
Motif
Other DBs
NCBI-GeneID: 936005
NCBI-ProteinID: NP_389341
Pasteur: BG10207
BSORF: BG10207
UniProt: P21881
Position
1528326..1529441
Genome map
AA seq 371 aa AA seqDB search
MAAKTKKAIVDSKKQFDAIKKQFETFQILNEKGEVVNEAAMPDLTDDQLKELMRRMVFTR
VLDQRSISLNRQGRLGFYAPTAGQEASQIATHFALEKEDFVLPGYRDVPQLIWHGLPLYQ
AFLFSRGHFRGNQMPDDVNALSPQIIIGAQYIQTAGVALGLKKRGKKAVAITYTGDGGAS
QGDFYEGINFAGAYKAPAIFVVQNNRYAISTPVEKQSAAETIAQKAVAAGIVGVQVDGMD
PLAVYAATAEARERAINGEGPTLIETLTFRYGPHTMAGDDPTKYRTKEIENEWEQKDPLV
RFRAFLENKGLWSEEEEAKVIEDAKEEIKQAIKKADAEPKQKVTDLMKIMYEKMPHNLEE
QFEIYTQKESK
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaaaaacgaaaaaagctatcgttgacagtaagaagcaatttgatgccattaaa
aagcagttcgaaacgttccaaattttaaatgaaaagggagaagtcgtgaatgaagcggcg
atgcctgatttaactgatgatcaattaaaagagctaatgcgccgcatggtatttacgcgt
gtgcttgaccaacgctctatctcattaaaccgtcaaggacgtctcggattttacgctcct
actgcgggtcaagaagcttctcagattgcaacgcatttcgcgcttgaaaaagaagacttt
gttcttcctggataccgtgatgtgcctcagttaatttggcacggccttccattatatcaa
gcgtttcttttctctcgcggacatttcagaggaaaccaaatgcctgatgatgtgaatgcc
ctttctccacaaatcattatcggtgctcaatacattcaaactgccggtgttgcgctaggt
cttaaaaaacgcggtaagaaagctgtcgcaatcacttacactggtgacggcggagcttct
caaggggacttctacgaaggaattaactttgccggagcttataaagcacctgcaatcttc
gtggtgcaaaacaaccgttacgcgatttcaactcctgttgaaaaacaatctgcagctgaa
acaattgcacaaaaagctgtagctgccggtattgtcggcgtacaagtagacggaatggat
ccgcttgctgtatacgcagcaactgctgaagcacgcgagcgcgcaatcaacggcgaaggt
ccaacactaattgaaacacttacattccgttatggcccgcacacaatggctggtgacgat
cctactaaatatcgtacaaaagaaatcgaaaatgagtgggaacaaaaagatccgcttgta
cgtttccgtgcgttccttgaaaacaaaggcttatggtctgaagaagaagaagcaaaagtg
attgaggatgcgaaagaagaaattaagcaagcgatcaaaaaagctgatgctgaaccgaag
caaaaagtaactgatttaatgaaaatcatgtacgaaaaaatgcctcacaaccttgaggag
caatttgaaatttatacacagaaggagtcgaagtaa

DBGET integrated database retrieval system