KEGG   Bacillus subtilis subsp. subtilis 168: BSU14590Help
Entry
BSU14590          CDS       T00010                                 

Gene name
pdhB
Definition
(RefSeq) pyruvate dehydrogenase E1 component subunit beta
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00020  Citrate cycle (TCA cycle)
bsu00620  Pyruvate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01130  Biosynthesis of antibiotics
bsu01200  Carbon metabolism
Module
bsu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU14590 (pdhB)
   00020 Citrate cycle (TCA cycle)
    BSU14590 (pdhB)
   00620 Pyruvate metabolism
    BSU14590 (pdhB)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     BSU14590 (pdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II
Motif
Other DBs
NCBI-GeneID: 939496
NCBI-ProteinID: NP_389342
Pasteur: BG10208
BSORF: BG10208
UniProt: P21882
Position
1529445..1530422
Genome map
AA seq 325 aa AA seqDB search
MAQMTMIQAITDALRTELKNDENVLVFGEDVGVNGGVFRATEGLQKEFGEDRVFDTPLAE
SGIGGLALGLGLNGFRPVMEIQFFGFVYEVMDSVSGQMARMRYRSGGRWTSPVTIRSPFG
GGVHTPELHADSLEGLVAQQPGIKVVIPSTPYDAKGLLISAIRDNDPVVFLEHMKLYRSF
RQEVPEEEYTIELGKADVKREGTDLSIITYGAMVHESLKAADELEKDGISAEVVDLRTVS
PLDIDTIIASVEKTGRAIVVQEAQKQAGIAANVVAEINDRAILSLEAPVLRVAAPDTVFP
FSQAESVWLPNHKDVLETARKVLEF
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaatgacaatgattcaagcaatcacggatgcgttacgcacagaactgaaaaat
gacgaaaatgtcttagttttcggagaagacgttggtgtaaacggcggcgtattccgtgcg
acagaaggattgcaaaaagaattcggtgaagaccgtgtgtttgacacgccacttgctgaa
tctggtatcggcggtcttgcccttggtttaggcttaaacggcttccgtccggtaatggaa
atccaattcttcggatttgtttatgaagtaatggattcagtttctggccaaatggctcgt
atgcgctaccgttctggcggacgctggacttcacctgtaacaattcgttctccattcggc
ggcggtgttcatactcctgaacttcacgctgacagcttggaaggtcttgttgcacaacag
cctggtatcaaagttgttattccatcaactccttacgatgccaaaggacttttaatttct
gcgatcagagacaatgatcctgttgtcttcttagagcatatgaagctttaccgttctttc
cgtcaggaagttcctgaagaagaatacacaattgagcttggaaaagctgacgtgaaacgt
gaaggtactgatctttcaatcatcacttacggcgcaatggttcatgaatcattaaaagct
gctgatgagcttgaaaaagacggcatttctgctgaagttgtcgaccttcgtacagtaagc
ccacttgatatcgatacaattatcgcctctgtagaaaaaacaggacgcgcgattgtcgtt
caagaggcacaaaaacaagccggtattgctgcaaacgtagtagcagaaattaatgaccgt
gcgatcctgagcttggaagcacctgtacttcgcgttgcagcgccagatacagtatttcct
ttctctcaagcggagagcgtatggcttccaaaccataaagacgttcttgaaacagcaaga
aaagtgcttgaattttaa

DBGET integrated database retrieval system