KEGG   Bacillus subtilis subsp. subtilis 168: BSU14620Help
Entry
BSU14620          CDS       T00010                                 

Gene name
slp
Definition
(RefSeq) Pal-related lipoprotein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin
Motif
Other DBs
NCBI-GeneID: 935991
NCBI-ProteinID: NP_389345
Pasteur: BG10211
BSORF: BG10211
UniProt: P39910
Position
complement(1533327..1533701)
Genome map
AA seq 124 aa AA seqDB search
MRYRAVFPMLIIVFALSGCTLSTINPMKKSRIDNIHHTQILFFSDENQIDQEAPYYDALL
DLEKDYPEQIDKMKVYDKKEGWEDEIETVPTLMVVDQRHVVVKIEGCVKKKEDIIKPLQH
VLSK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcgatatcgcgcggtattccccatgctgataatagtatttgctttatcgggctgtacg
ctttccaccatcaatccgatgaaaaaaagccggattgacaacattcatcatacacaaatc
ctgtttttttctgatgagaaccaaatagaccaggaagcgccttattacgatgcactgctt
gatttagaaaaagattatcccgagcaaatagataaaatgaaggtctatgataaaaaagaa
ggctgggaagatgagattgaaactgtccctacccttatggttgttgatcagcgccatgtc
gtggtgaaaatcgagggatgtgtgaaaaagaaagaagacatcattaaaccattacagcat
gtgctgtcaaaataa

DBGET integrated database retrieval system