KEGG   Bacillus subtilis subsp. subtilis 168: BSU14629Help
Entry
BSU14629          CDS       T00010                                 

Gene name
ykzW
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SR1P
Motif
Other DBs
NCBI-GeneID: 8302953
NCBI-ProteinID: YP_003097726
UniProt: C0H410
Position
1534120..1534239
Genome map
AA seq 39 aa AA seqDB search
MGTIVCQDCNEAIHYFEDEKVTTLYGTCCGQCQCPVDEE
NT seq 120 nt NT seq  +upstreamnt  +downstreamnt
atgggtacgattgtttgccaagattgcaacgaagccattcattactttgaagatgagaaa
gtgacaacattatatggaacttgctgcggacaatgtcaatgtcctgttgatgaagagtaa

DBGET integrated database retrieval system