KEGG   Bacillus subtilis subsp. subtilis 168: BSU14630Help
Entry
BSU14630          CDS       T00010                                 

Gene name
speA
Definition
(RefSeq) arginine decarboxylase
  KO
K01585  arginine decarboxylase [EC:4.1.1.19]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00330  Arginine and proline metabolism
bsu01100  Metabolic pathways
Module
bsu_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BSU14630 (speA)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.19  arginine decarboxylase
     BSU14630 (speA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OKR_DC_1 OKR_DC_1_C Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 SepSecS Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 936002
NCBI-ProteinID: NP_389346
Pasteur: BG10212
BSORF: BG10212
UniProt: P21885
Position
complement(1534279..1535751)
Genome map
AA seq 490 aa AA seqDB search
MSQHETPLYTGLKKHASRQPVQFHIPGHKKGAGMDPEFRQFIGENALSIDLINIEPLDDL
HAPKGIIKQAQDLAAEAFGADHTFFSVQGTSGAIMTMVMAVCGPGDKIIIPRNVHKSIMT
AIVFSGAVPIFIHPEIDNELGISHGITLESAKRALTEHPDAKGLLVINPTYFGVAADLKS
IVELAHSFDVPVLVDEAHGVHIHFHDELPLSAMQAGADIAATSVHKLGGSLTQSSILNMR
EGLVSKDRVQSILSMLTTTSTSYLLLASLDVARKRLATEGRQLAEETLKLANQTRDRLNQ
IEGIYCVGSEILGSKAAYSYDPTKLIISVKSLGLTGHDVEKWLRESFNIEVELSDLYNIL
CIFTPGDSQNDADRLVEALTEIAQQMSEQDVTHQQTEVLLPEIPLLAMTPRDAFYANTEV
IPLKEASGRIIAEFVMVYPPGIPIFIPGEIITEENISYIFKNLDAGLPVQGPEDSTLHMI
RVIKEQKAIQ
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgcaacatgaaacacccttatacacaggactgaaaaagcatgcaagcagacagcct
gttcaattccacattcccggccataaaaaaggggcaggaatggacccagaattcagacaa
tttatcggtgaaaacgcgttaagcatagatttgattaatattgaaccattagacgatctg
cacgcgccaaaaggcattattaaacaagcacaagatctggctgctgaagcatttggagcg
gatcatacatttttttctgttcaaggaacaagcggcgccattatgacaatggtaatggct
gtttgcggacctggtgataaaattattattccaagaaatgttcataaatcaattatgaca
gctattgtattttccggagcggttccaatttttattcatcctgaaattgacaatgaattg
ggcatctcccacggaattacacttgaatctgctaaacgggcgcttaccgagcatccggat
gcaaaagggcttctcgtcatcaacccgacatatttcggtgttgcagccgacttaaaaagc
atcgtagaactcgctcattcgtttgatgtgccagtgcttgtggatgaagcacacggcgtt
cacattcattttcacgacgaattgccgctatcggctatgcaggcaggagcggacatagca
gcgacaagtgtacacaagctgggcggatcactgacacaaagctctattttaaacatgaga
gaaggccttgtatctaaagacagagtgcaatccatcctgagcatgctgacaactacgtca
acttcttacttgcttctcgcttctttggatgttgccagaaaacgccttgcaacagaaggc
cgccagcttgctgaggaaacactcaagcttgccaatcagacgagagatcgcctcaatcag
attgaaggcatttattgtgtcggttctgagattcttgggtcgaaagcagcttacagctat
gatccgacaaaattgattatctctgtgaaaagtcttggcctgacaggacatgacgtggaa
aaatggcttcgtgaatcctttaatattgaggtggagctttctgatctgtacaatattttg
tgtattttcactcctggtgacagccaaaatgatgcagaccggcttgtagaggctttaact
gagatcgcacagcaaatgtcagaacaagatgtaacacatcagcaaactgaggttctgctt
ccagaaatacctttattggcaatgactccgcgtgatgctttctatgcaaatacggaagtc
atcccattaaaagaagcatccggacggattattgctgaatttgtcatggtatatccgcct
ggtattccaatcttcatcccaggagaaattattacagaagaaaacatcagctacattttt
aaaaaccttgacgcaggcctccctgttcaaggacctgaggactcgactttacatatgatc
cgggtcatcaaagaacaaaaagcaattcaataa

DBGET integrated database retrieval system