KEGG   Bacillus subtilis subsp. subtilis 168: BSU14640Help
Entry
BSU14640          CDS       T00010                                 

Gene name
yktA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0223
Motif
Other DBs
NCBI-GeneID: 935989
NCBI-ProteinID: NP_389347
Pasteur: BG11816
BSORF: BG11816
UniProt: Q45497
Position
1535936..1536202
Genome map
AA seq 88 aa AA seqDB search
MEYQYPMNEDWTTEEAVDVIAFFQQVELAYEKGADREELLKAYRRFKEIVPGKAEEKKLC
GEFEEQSTYSPYRTVKQARESDHAKIKM
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atggagtatcaatatccgatgaatgaagattggacaaccgaagaagcagtggatgtgatt
gcatttttccagcaggttgagcttgcatatgaaaaaggggcggatcgtgaagaactgctt
aaagcttaccgccgtttcaaggaaattgtaccggggaaggccgaagaaaaaaagctatgc
ggcgagtttgaggaacaaagtacatattctccttatcgcacggtcaaacaggcgagagaa
tctgatcacgcgaagattaagatgtaa

DBGET integrated database retrieval system