KEGG   Bacillus subtilis subsp. subtilis 168: BSU14640
Entry
BSU14640          CDS       T00010                                 
Symbol
yktA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: UPF0223
Other DBs
NCBI-GeneID: 935989
NCBI-ProteinID: NP_389347
Pasteur: BG11816
UniProt: Q45497 A0A6M3ZAC6
Position
1535936..1536202
AA seq 88 aa
MEYQYPMNEDWTTEEAVDVIAFFQQVELAYEKGADREELLKAYRRFKEIVPGKAEEKKLC
GEFEEQSTYSPYRTVKQARESDHAKIKM
NT seq 267 nt   +upstreamnt  +downstreamnt
atggagtatcaatatccgatgaatgaagattggacaaccgaagaagcagtggatgtgatt
gcatttttccagcaggttgagcttgcatatgaaaaaggggcggatcgtgaagaactgctt
aaagcttaccgccgtttcaaggaaattgtaccggggaaggccgaagaaaaaaagctatgc
ggcgagtttgaggaacaaagtacatattctccttatcgcacggtcaaacaggcgagagaa
tctgatcacgcgaagattaagatgtaa

DBGET integrated database retrieval system