KEGG   Bacillus subtilis subsp. subtilis 168: BSU14660Help
Entry
BSU14660          CDS       T00010                                 

Gene name
ykzI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1090 MobB
Motif
Other DBs
NCBI-GeneID: 935992
NCBI-ProteinID: NP_389349
Pasteur: BG13337
BSORF: BG13337
UniProt: O31719
Position
1537113..1537301
Genome map
AA seq 62 aa AA seqDB search
MRQVVKEGFKEEKNNRVAVWRLEVDYELATLYEAMQKENEEQIEQSKNKLERLRKEWIRL
NG
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaagttgtaaaagagggatttaaggaagagaaaaacaatcgtgttgctgtctgg
agactagaggttgattatgaattggcaaccctatatgaagcaatgcagaaagaaaatgaa
gagcagattgaacaaagcaaaaacaaacttgagcgacttagaaaagaatggattcgtctt
aacgggtaa

DBGET integrated database retrieval system