KEGG   Bacillus subtilis subsp. subtilis 168: BSU14670Help
Entry
BSU14670          CDS       T00010                                 

Gene name
suhB
Definition
(RefSeq) inositol-1-monophosphatase
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00521  Streptomycin biosynthesis
bsu00562  Inositol phosphate metabolism
bsu01100  Metabolic pathways
bsu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BSU14670 (suhB)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BSU14670 (suhB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     BSU14670 (suhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-GeneID: 935986
NCBI-ProteinID: NP_389350
Pasteur: BG11818
BSORF: BG11818
UniProt: Q45499
Position
1537441..1538238
Genome map
AA seq 265 aa AA seqDB search
MTNWTEIDEIAKKWIREAGARITQSMHESLTIETKSNPNDLVTNIDKETEKFFIDRIQET
FPGHRILGEEGQGDKIHSLEGVVWIIDPIDGTMNFVHQQRNFAISIGIFENGEGKIGLIY
DVVHDELYHAFSGRGAYMNETKLAPLKETVIEEAILAINATWVTENRRIDQSVLAPLVKR
VRGTRSYGSAALELANVAAGRIDAYITMRLAPWDYAAGCVLLNEVGGTYTTIEGEPFTFL
ENHSVLAGNPSIHKTIFEEYLHARK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgacaaattggacggaaatcgatgagattgcaaagaaatggataagagaagcaggcgcg
agaattacacaatccatgcatgaaagcctgacaattgaaacgaaatcaaatccgaatgat
ttagtcaccaatattgacaaagaaaccgaaaagtttttcattgatcgaattcaagaaaca
tttccgggacatcggatactcggtgaagaggggcaaggagacaaaatccactcacttgag
ggagtcgtatggattattgatccgattgatgggacgatgaattttgtgcaccagcaaaga
aattttgcgatttccattgggatttttgaaaacggtgaaggtaaaatcggtttaatttat
gatgtggtgcacgatgagttgtatcacgcatttagcggcagaggagcttatatgaatgaa
acgaagctggctccattaaaagaaaccgtcattgaagaagcgattcttgccattaatgca
acatgggtaacggaaaacagaagaattgatcaaagtgtgttagcgccacttgtgaaaaga
gtcagaggcacacgctcctacggttctgccgctttagagctggcaaatgtcgcggcagga
agaatagatgcttacatcacgatgcggcttgcgccatgggactacgcagccggctgtgtg
ctgttaaatgaagtaggaggcacctatacgaccattgaaggagagccgtttaccttttta
gaaaaccacagtgtgctagccggaaacccatctatacataaaacgatatttgaagagtat
cttcatgctcggaagtag

DBGET integrated database retrieval system