KEGG   Bacillus subtilis subsp. subtilis 168: BSU14680Help
Entry
BSU14680          CDS       T00010                                 

Gene name
ykzC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_4 FR47 Acetyltransf_10 Nudix_hydro
Motif
Other DBs
NCBI-GeneID: 935976
NCBI-ProteinID: NP_389351
Pasteur: BG13331
BSORF: BG13331
UniProt: O31720
Position
1538264..1538692
Genome map
AA seq 142 aa AA seqDB search
MLEKLAEAHPVWKEEEFGDKDAEDYIISYSMYNGSWLVWEKDGMPVAVSYHLEWSPSNGK
PWLGTVLIDPAEEKKGHAKMIIEQISKLLRAKHKAMFAGVPIERREWILFLSQCGFEQLK
TEKDEKGKSFMILVKPLAEAAV
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
ttgttagaaaagctcgcggaggctcatcctgtatggaaagaggaggagtttggagataaa
gatgcagaagactatatcatttcctactccatgtacaacggttcatggcttgtatgggaa
aaagacggtatgcctgttgccgtcagctaccatctcgagtggtctccttcaaacggtaag
ccgtggctcggaacggtcctgattgacccggctgaagaaaaaaagggacatgcgaagatg
atcattgaacagatcagcaaattgcttagagcgaaacataaagcgatgtttgcgggagtt
cccattgagcgcagggaatggatactgtttttaagccaatgcggctttgaacagctgaaa
acggaaaaagatgagaaaggcaaatcatttatgatcttggtgaagcctttagcagaagct
gccgtatga

DBGET integrated database retrieval system