KEGG   Bacillus subtilis subsp. subtilis 168: BSU14690Help
Entry
BSU14690          CDS       T00010                                 

Gene name
yktD
Definition
(RefSeq) S-adenosyl-L-methionine-dependent methyltransferase YktD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LCM Methyltransf_23
Motif
Other DBs
NCBI-GeneID: 935978
NCBI-ProteinID: NP_389352
Pasteur: BG11819
BSORF: BG11819
UniProt: Q45500
Position
complement(1538770..1539684)
Genome map
AA seq 304 aa AA seqDB search
MRKNESSLTSLISAFARAYHSRYDTPLIFDDFIAKDLINEKEFIDISKNMIQEISFFNKE
IAERLQNDPEKILKWVAQIQLSPTPLARASYCEKVLHNELILGAKQYVILGAGLDTFCFR
HPELENSLQVFEVDHPATQQLKKNKLKDANLTIPGHLHFVPMDFTKTFSYDPLLDEGFKN
TKTFFSLLGVSYYVTREENASLISNLFSHVPPGSSIVFDYADETLFTAKGTSNRVEHMVK
MAAASGEPMKSCFTYQEIEHLLESSGLLIYEHLSPDDINDLFFSNRKDNLSAFETIHYIH
AVKK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaaaatgagtccagcttaacgtctctaatttcagcttttgcccgtgcatatcac
agccgatatgacacacctcttatttttgatgattttatcgcaaaagatctcattaacgaa
aaagagtttatcgacatcagtaaaaatatgattcaagaaatatcgtttttcaacaaagag
atcgccgaacgtcttcaaaatgatcctgaaaaaatattaaaatgggttgcacaaatccag
ctgtctccaacgcccctagcacgtgcttcttattgtgaaaaagtcttgcacaacgaatta
atcctgggggcaaaacagtatgtcattcttggagcgggactggatactttctgctttcgg
catccagaattagaaaacagcttacaggttttcgaggttgatcatccggccacacagcaa
ttgaaaaaaaataagctgaaggatgcaaatctgacaattccgggtcatcttcattttgtt
cctatggatttcaccaaaacgttttcgtatgatcctctcttagatgaaggatttaaaaac
acaaaaacattcttcagccttctcggagtgtcttattatgtaacacgggaagaaaatgca
agcttgatcagcaatttattttctcatgtcccgcctggaagctctattgtttttgattat
gcggacgaaacactttttacagcaaaagggacgtcgaatcgagttgaacatatggtgaag
atggctgccgcaagcggggaaccgatgaaatcatgtttcacttatcaagagattgaacat
ctgttagagtcatctggtttactgatctatgaacatctatcaccagacgacatcaatgac
cttttctttagtaatcgaaaagacaatttgtcagcgtttgaaacgattcattatattcat
gcggtaaaaaaataa

DBGET integrated database retrieval system