KEGG   Bacillus subtilis subsp. subtilis 168: BSU14700Help
Entry
BSU14700          CDS       T00010                                 

Gene name
nprE
Definition
(RefSeq) bacillolysin
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bsu01002]
    BSU14700 (nprE)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     BSU14700 (nprE)
Peptidases [BR:bsu01002]
 Metallo Peptidases
  Family M4: thermolysin family
   BSU14700 (nprE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4 Peptidase_M4_C FTP PepSY DUF4901
Motif
Other DBs
NCBI-GeneID: 935981
NCBI-ProteinID: NP_389353
Pasteur: BG10448
BSORF: BG10448
UniProt: P68736
Position
complement(1540036..1541601)
Genome map
AA seq 521 aa AA seqDB search
MGLGKKLSVAVAASFMSLSISLPGVQAAEGHQLKENQTNFLSKNAIAQSELSAPNDKAVK
QFLKKNSNIFKGDPSKRLKLVESTTDALGYKHFRYAPVVNGVPIKDSQVIVHVDKSDNVY
AVNGELHNQSAAKTDNSQKVSSEKALALAFKAIGKSPDAVSNGAAKNSNKAELKAIETKD
GSYRLAYDVTIRYVEPEPANWEVLVDAETGSILKQQNKVEHAAATGSGTTLKGATVPLNI
SYEGGKYVLRDLSKPTGTQIITYDLQNRQSRLPGTLVSSTTKTFTSSSQRAAVDAHYNLG
KVYDYFYSNFKRNSYDNKGSKIVSSVHYGTQYNNAAWTGDQMIYGDGDGSFFSPLSGSLD
VTAHEMTHGVTQETANLIYENQPGALNESFSDVFGYFNDTEDWDIGEDITVSQPALRSLS
NPTKYNQPDNYANYRNLPNTDEGDYGGVHTNSGIPNKAAYNTITKLGVSKSQQIYYRALT
TYLTPSSTFKDAKAALIQSARDLYGSTDAAKVEAAWNAVGL
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
gtgggtttaggtaagaaattgtctgttgctgtcgctgcttcgtttatgagtttatcaatc
agcctgccaggtgttcaggctgctgaaggtcatcagcttaaagagaatcaaacaaatttc
ctctccaaaaacgcgattgcgcaatcagaactctctgcaccaaatgacaaggctgtcaag
cagtttttgaaaaagaacagcaacatttttaaaggtgacccttccaaaaggctgaagctt
gttgaaagcacgactgatgcccttggatacaagcactttcgatatgcgcctgtcgttaac
ggagtgccaattaaagattcgcaagtgatcgttcacgtcgataaatccgataatgtctat
gcggtcaatggtgaattacacaatcaatctgctgcaaaaacagataacagccaaaaagtc
tcttctgaaaaagcgctggcactcgctttcaaagctatcggcaaatcaccagacgctgtt
tctaacggagcggccaaaaacagcaataaagccgaattaaaagcgatagaaacaaaagac
ggcagctatcgtcttgcttacgacgtgacgattcgctatgtcgagcctgaacctgcaaac
tgggaagtcttagttgacgccgaaacaggcagcattttaaaacagcaaaataaagtagaa
catgccgccgccactggaagcggaacaacgctaaagggcgcaactgttcctttgaacatc
tcttatgaaggcggaaaatatgttctaagagatctttcaaaaccaacaggcacccaaatc
atcacatatgatttgcaaaacagacaaagccgccttccgggcacgcttgtctcaagcaca
acgaaaacatttacatcttcatcacagcgggcagccgttgacgcacactataacctcggt
aaagtgtacgattatttttattcaaactttaaacgaaacagctatgataacaaaggcagt
aaaatcgtttcttccgttcactacggcactcaatacaataacgctgcatggacaggagac
cagatgatttacggtgatggcgacggttcattcttctctccgctttccggctcattagat
gtgacagcgcatgaaatgacacatggcgtcacccaagaaacagccaacttgatttatgaa
aatcagccaggtgcattaaacgagtctttctctgacgtattcgggtattttaacgataca
gaagactgggacatcggtgaagacattacggtcagccagcctgctcttcgcagcctgtcc
aaccctacaaaatacaaccagcctgacaattacgccaattaccgaaaccttccaaacaca
gatgaaggcgattatggcggtgtacacacaaacagcggaattccaaacaaagccgcttac
aacaccatcacaaaacttggtgtatctaaatcacagcaaatctattaccgtgcgttaaca
acgtacctcacgccttcttccacgttcaaagatgccaaggcagctctcattcagtctgcc
cgtgacctctacggctcaactgatgccgctaaagttgaagcagcctggaatgctgttgga
ttgtaa

DBGET integrated database retrieval system