KEGG   Bacillus subtilis subsp. subtilis 168: BSU14710Help
Entry
BSU14710          CDS       T00010                                 

Gene name
ylaA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_holin_5_2
Motif
Other DBs
NCBI-GeneID: 935984
NCBI-ProteinID: NP_389354
Pasteur: BG13338
BSORF: BG13338
UniProt: O07625
Position
1541886..1543826
Genome map
AA seq 646 aa AA seqDB search
MLFVLELFSHYVLHFERYFILSRQSTLLIQWSIVVLAGLYLLVHHPKINRQRTMFLAGVI
LRIVLLAGVSVELIHQVQSTNFTSAYLREDGKELLPLLHFLLYGYVLLTAFHYMLMPRDH
GGKGKFYTFDLAVVSLPIVQMIFSFFSYWKEYPDGMEPIAFVFLFFIITLPIALNVVFFK
LYWRTDKILLGLFYTLIIGLLVLLLAPYPNQISKDYGAVMPYTIYLAMAGFLMSYHLFQK
SGKVYVRVNKWVTMAVMVFFVLLLNPIYNIGTAAFAVSKPANVHDSFNFVGEHISSEKAE
QILKSFFPTDETLYLHDTNMDVHYFYSFESKGYKAEVDEVSQLIRNYEYLQKAHGKKLTN
QEYKRKSIAFLERHGRVLHKDHIETKVSQEDGQTVVRIYLKNQLHKKDHADDGAVFYWEK
ETLMGFSEDPSIYQLDSLLHVHITEQDIHDKVEQMFTALNISKQPYQITDIESDSLLGSM
VRVETKVGIVLEFEGESGCLHSLSLPMKKNISMANSRLQHQILSIFDARGSEKKKKSSQG
DMVMYTDSSKTYEFVEAQGQLNVYVYSDTPDQSFPYTYRNGTLAYEKVASLYQDVIYKKR
MRPIIVQRGDERHYAWLIIIQPFGSNRHDAYVVDGETQEVKSLYES
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
ttgttgttcgtgttggagttattcagtcattatgtattgcatttcgaacgttattttata
ttaagcagacaaagcaccctgctgattcaatggtcaattgttgttctggcgggcttatat
cttttggtgcatcatcccaaaataaaccggcagcgcacaatgttcttggcgggtgttata
ttgcggattgtgctgctggcgggagtgtctgttgaacttattcaccaggtgcaatcaaca
aacttcaccagcgcttacttaagagaggacggaaaagaactgctgccgctgctgcatttt
ttgttatacggatatgtgctgctgacggcttttcactatatgctgatgccgcgtgatcat
ggcggaaagggtaagttttatacgttcgaccttgctgttgtcagtttgccgatcgtacaa
atgatttttagtttcttttcgtattggaaggaatacccggatgggatggagccgattgca
ttcgtgtttctgtttttcatcatcactcttcccattgcgttgaatgtagtgtttttcaag
ctgtattggagaacggataagatcttactaggcttattttatacgctgattatcggactg
cttgtcttgctgcttgcgccatatcccaatcaaatctcaaaagattatggtgcagtaatg
ccatatacgatttatttggcaatggcgggatttttgatgagctatcatctgttccaaaag
tcaggaaaggtttatgtgcgtgtgaataagtgggtgacgatggctgtcatggtgtttttt
gtcctgctgttaaatccgatatataacataggaacggctgctttcgctgtatcaaagcca
gcaaatgtccatgattcattcaattttgtcggggagcacatttcatcagaaaaagcggaa
cagatactaaagtcattttttcctacggatgaaacactttatttgcacgatacaaacatg
gatgtgcattatttctactcatttgaaagcaaaggttacaaagctgaggtagatgaagta
tcgcagctaattcgtaattatgaatacttacaaaaagcacatgggaaaaagctaacgaat
caggagtacaagcgaaagtccatcgctttccttgagcgacacggacgtgtgttacataag
gatcatatcgaaacaaaggtatctcaagaagacggccagacagtcgtacgtatttacctg
aaaaatcaacttcataaaaaagatcatgctgatgatggcgcggtattttattgggaaaag
gaaaccttaatggggtttagtgaagatccttcgatttatcagcttgactctcttctgcat
gttcatataacggaacaagacattcacgacaaagtggaacaaatgtttacagcgctgaac
atatcaaaacagccttatcagatcactgatattgaaagcgacagcctgcttggaagcatg
gtgagagttgaaacaaaagttggaattgttttggaatttgagggcgaatcaggttgttta
catagtctttcgcttccgatgaaaaagaatatctcaatggctaacagccggctgcagcat
cagatattatcgatcttcgatgctcgtggatcagaaaagaagaaaaaaagcagtcagggt
gacatggtgatgtatactgattcttctaaaacatatgagtttgttgaagctcaaggtcag
ctaaacgtttatgtatacagcgatacacctgatcagtcattcccctatacgtatcgtaat
ggaacattggcttacgaaaaagtagcttctctatatcaggatgtcatttacaaaaagcgt
atgcgtccgattatcgttcaaagaggggatgaacggcattatgcatggctgatcattatt
cagccgtttggttcaaatcgccatgatgcctatgtagtggatggagaaacacaagaggtg
aaaagtctttatgaatcataa

DBGET integrated database retrieval system