KEGG   Bacillus subtilis subsp. subtilis 168: BSU14730Help
Entry
BSU14730          CDS       T00010                                 

Gene name
ylaC
Definition
(RefSeq) RNA polymerase sigma factor YlaC
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU14730 (ylaC)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     BSU14730 (ylaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r2 Sigma70_r4_2 Sigma70_r4 Sigma70_ECF HTH_23 HTH_24 HTH_AsnC-type HTH_Crp_2 DUF134
Motif
Other DBs
NCBI-GeneID: 935973
NCBI-ProteinID: NP_389356
Pasteur: BG13340
BSORF: BG13340
UniProt: O07627
Position
1544085..1544606
Genome map
AA seq 173 aa AA seqDB search
MKHRDSIEDLYRQYYQEILNYLFRRTHHLETAKDLAQDTFVKALNGLASFRGHSSIRTWL
YTIAHHTFINWYRRDVKYQFTEISKNEGLTQTTYDQPEQYLSRTVKSETLRQELLKLKDQ
HQSVLILREFQELSYEEIAEILGWSLSKVNTTLHRARLELKKNMTKSREEERI
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatagggattccattgaggacttgtatcggcagtattatcaagaaattttaaat
tatttattcagaaggactcatcatcttgaaacagccaaggacttagcgcaggacacgttt
gtaaaagctcttaacggtctggcttcgtttagggggcattcttccatcagaacatggctc
tacaccattgcgcatcatacctttatcaattggtaccgaagggatgtcaaataccaattt
actgaaatcagcaaaaatgaagggttaacgcaaacaacttatgaccagcctgaacagtat
ctgtcacggacggtgaaaagcgaaacactgcggcaggagctcctgaagttaaaagatcag
catcaatccgttttgattttaagagaattccaagagctttcttatgaagaaatcgctgag
atattaggatggagtctttctaaggtgaataccacattgcaccgggctagattagagcta
aagaaaaacatgacgaaaagtagagaggaggagcggatatga

DBGET integrated database retrieval system