KEGG   Bacillus subtilis subsp. subtilis 168: BSU14740Help
Entry
BSU14740          CDS       T00010                                 

Gene name
ylaD
Definition
(RefSeq) anti-sigma-YlaC factor YlaD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-HC2
Motif
Other DBs
NCBI-GeneID: 935961
NCBI-ProteinID: NP_389357
Pasteur: BG13341
BSORF: BG13341
UniProt: O07628
Position
1544603..1544896
Genome map
AA seq 97 aa AA seqDB search
MTCFLVRDLLPLYLEGDCKRETEHVIEEHLKMCSSCRDMYDTMAEPFELESEQAVEEAYL
PEEELRFKQRYYGLLIMKAACWFGAAVAMMLIIKLLI
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgacctgctttctagtaagagacctgcttcctctgtatcttgaaggtgattgtaaaaga
gaaacggaacacgttatagaagagcatttaaaaatgtgcagcagctgcagagacatgtat
gacacgatggctgagccatttgaattggaaagcgaacaggccgttgaggaggcttatctg
ccggaagaagaactgcgttttaaacagaggtactatggattactgatcatgaaagctgcc
tgctggtttggagcggcggttgccatgatgctgatcatcaaactgctgatataa

DBGET integrated database retrieval system