KEGG   Bacillus subtilis subsp. subtilis 168: BSU14750Help
Entry
BSU14750          CDS       T00010                                 

Gene name
ylaE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 935955
NCBI-ProteinID: NP_389358
Pasteur: BG13342
BSORF: BG13342
UniProt: O07629
Position
complement(1544936..1545547)
Genome map
AA seq 203 aa AA seqDB search
MKKTFVKKAMLTTAAMTSAALLTFGPDAASAKTPVDNTAVQLQHQASTNEDLNTFIDILN
QCIYEQDGVYYFDSEKAVELGMTKEEAQVIATLWESTSEFFSIVSQCVYLEDGNYKFDTE
KAVELGFTEKEALALEQFFSAVSLKIHILQAAIVLQDDVYSYDKDAALQAGATPLQADVY
EKLFSALSQEQLAAIYDMIHPQA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaacatttgtaaaaaaagctatgttaacgactgccgcaatgacctcagctgct
ctattaacgttcggtcctgatgcagccagcgcaaaaacaccggttgataacactgctgtt
caactccagcatcaggcgagcactaacgaagatctcaatacattcattgatatattaaat
caatgtatatacgaacaagacggtgtatattattttgacagcgaaaaagctgtcgagtta
ggaatgacaaaagaagaggctcaggtaattgctacactctgggaatcgacatcagaattt
ttcagcattgtttcacaatgtgtgtatctcgaggatggaaattacaaatttgatacagaa
aaagcagttgaacttggcttcacagaaaaagaagcacttgcacttgaacaatttttctcc
gctgtttctctcaagattcacattcttcaagcagccattgtgctacaagatgatgtgtac
agctatgataaagacgcagcgctacaagcaggtgcaacgccactgcaagctgacgtttat
gaaaaactcttcagtgccctgtcacaagaacagcttgccgctatttacgatatgattcat
ccccaggcttaa

DBGET integrated database retrieval system