KEGG   Bacillus subtilis subsp. subtilis 168: BSU14760Help
Entry
BSU14760          CDS       T00010                                 

Gene name
ylaF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5325 DUF3792 ABC2_membrane_3 DUF1129 DUF4131 Insulin_TMD
Motif
Other DBs
NCBI-GeneID: 935954
NCBI-ProteinID: NP_389359
Pasteur: BG13343
BSORF: BG13343
UniProt: O07630
Position
complement(1545820..1546008)
Genome map
AA seq 62 aa AA seqDB search
MKKMNWLLLLFAFAAVFSIMLIGVFIAEKSPAGIIASIVLVCAVMGGGFTLKKKMREQGL
LD
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgaattggcttttactattatttgcatttgcagcggttttcagcattatg
ctgatcggcgtctttatcgctgaaaaaagccctgcaggcattatcgccagcattgtactt
gtttgcgctgtcatgggcggcggatttacattaaaaaagaaaatgcgcgaacaaggcttg
cttgattaa

DBGET integrated database retrieval system